KEGG   Rufibacter sp. DG15C: TH61_11520Help
Entry
TH61_11520        CDS       T04326                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
rud  Rufibacter sp. DG15C
Brite
KEGG Orthology (KO) [BR:rud00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rud02000]
    TH61_11520
Transporters [BR:rud02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    TH61_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 TsaE AAA_16 AAA Zeta_toxin APS_kinase AAA_30 AAA_29
Motif
Other DBs
NCBI-ProteinID: AMM51683
UniProt: A0A127B2G0
LinkDB All DBs
Position
2693913..2694830
Genome map
AA seq 305 aa AA seqDB search
MQPILQIKGVSKQYEAHRALNNVSFDVPMGSIFGLLGPNGAGKTSLIRIITQITAADEGQ
VLLDGEPLRPEHIQQVGYLPEERGLYKKMKVGEQLIYLARLRGLSKADATSKIKIWADRL
SLREWLTKSVEDLSKGMQQKVQFIATVLHEPKLLILDEPFSGFDPVNANIIRDEILKLKE
QGCTIIFSTHRMESVEQLCDHIALIHKSEKVLDGSLQDIKAKFKNHLYTLEGEGKLLITS
PDFEVIQQQQEGNHFKAEVQLEPNISPNDLLRYLLDRVEVHCFQEKVPSIHDIFIKTVTE
EVHHG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaccaattctacagataaaaggcgtcagcaagcagtacgaagcccacagagccctc
aacaacgtttcctttgacgtgcccatggggagcatcttcgggctgttggggccgaacggg
gcgggcaagacgtcgctcatcagaatcattacccagattacggctgccgatgaaggccaa
gtgttgctggatggcgagccgctacgacctgagcacattcaacaagtaggctatctgccc
gaggagcgcggtctttataagaaaatgaaggtaggcgagcagttaatttacttggctaga
cttcggggcttgtctaaagcggatgccacctccaaaattaaaatctgggcagaccgcctg
agcctgcgcgagtggcttaccaaaagcgtggaggacctgtccaagggcatgcaacagaag
gtgcagtttattgccaccgtcctgcatgagcccaagctgttgattctggacgagccattc
tcgggcttcgaccccgtaaatgccaacatcatacgggatgaaatcctgaagctgaaggag
cagggctgtaccatcatcttctctacccaccgcatggagtcggtggagcagttgtgtgac
cacattgcgctcattcataagtctgagaaagtgctagacggtagcctgcaagacataaag
gccaagtttaagaaccatttgtatacgcttgagggcgaaggcaaactgctcatcacctcg
ccagatttcgaagtcatccaacaacagcaggaaggcaaccactttaaggctgaggtacaa
ttggagcccaacatcagccccaatgacttgcttcgctatttactggaccgggtggaggtg
cattgctttcaggagaaggtgcctagcattcatgatattttcattaaaaccgtaacagag
gaggtgcaccatgggtaa

DBGET integrated database retrieval system