KEGG   Rufibacter sp. DG15C: TH61_13380Help
Entry
TH61_13380        CDS       T04326                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rud  Rufibacter sp. DG15C
Pathway
rud00010  Glycolysis / Gluconeogenesis
rud00020  Citrate cycle (TCA cycle)
rud00620  Pyruvate metabolism
rud01100  Metabolic pathways
rud01110  Biosynthesis of secondary metabolites
rud01120  Microbial metabolism in diverse environments
rud01130  Biosynthesis of antibiotics
rud01200  Carbon metabolism
Module
rud_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TH61_13380
   00020 Citrate cycle (TCA cycle)
    TH61_13380
   00620 Pyruvate metabolism
    TH61_13380
Enzymes [BR:rud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TH61_13380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 HlyD_3 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: AMM51975
UniProt: A0A127B461
LinkDB All DBs
Position
complement(3133326..3135059)
Genome map
AA seq 577 aa AA seqDB search
MAEIIRMPKMSDTMTDGVIASWLKKVGDSVKSGDVLAEVETDKATMELESYEDGTLLYIG
PKNGESVPVDGVLAIIGKEGEDISGLMAEVNGGGAAPAPKAEEAPKAEAPKEEPKKEEAA
PAPQPAAAAPTANVNAEIVRMPKMSDTMTDGTIVAWHKKVGDKVKSGDLLAEVETDKATM
ELESYEDGTLLYIGVEAGASVAVDGVLCIIGEAGADYQALLNGGAQSGGNANPATAPTQE
QATRLEEHKTEAQSQSGDGVGQASSLPTPAPAASGAAPATGNQGRVLASPLAKKVAQEKG
ISLTDVKGSGENGRIVLRDVENFTPSAAAPRTQAPVASAPATPAAPVAAPGEAYSEVLVS
QMRKIIAKRLAESKFSAPHFYLTMEIDMDRAMEARVSINEVSPVKVSFNDLVIKAAAAAL
RKHPAVNSSWLGDKIRYNNVINIGVAVAVEDGLLVPVVRNADQKTLSAISAEVKDLGGKA
KSKKLQPSDWEGNTFTISNLGMFGIEEFTAIINPPDACILAVGGIKQTPVVKNGQIQIGN
IMKVTLSCDHRVVDGAVGSAFLQTLKGFLEDPVRMLV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcatccgaatgcccaagatgagcgacactatgaccgacggcgtgattgcc
agttggttaaagaaagttggtgattctgtgaaatctggggacgttctcgccgaagtggaa
accgacaaggcgaccatggaactagagtcttacgaagacggaaccttattatatattggc
cccaaaaatggtgagtcagttccggtagacggcgttctggccattattggaaaagaaggc
gaagatatttctggcctcatggccgaggtgaacggcggcggcgcagcccctgccccaaag
gcagaagaggcccccaaagccgaagcgcccaaggaagagcctaagaaggaagaagccgct
cccgccccgcaaccagccgctgctgctcctaccgccaatgtgaacgccgagattgtgcgc
atgcccaagatgagcgacaccatgaccgatggcaccattgtggcctggcacaaaaaagtg
ggcgacaaagtaaaatctggcgacctgctagccgaagtagagactgacaaagccactatg
gagttggagtcttacgaagacggcacgctattatatatcggtgtagaagctggggcctca
gtagccgtagacggtgttctttgcatcataggtgaagccggcgctgactaccaagcctta
ttgaacggcggcgcgcaaagtggcggaaacgccaacccggccactgcccctacccaagaa
caagccacccgcttagaagaacataaaaccgaagcccagtcgcagtctggcgacggcgtt
ggccaggcctcaagcttgcctactccggcccctgcggcttctggcgctgccccagccact
ggcaaccagggacgtgtactggcatcgccgttggcaaagaaggtagcccaggagaaaggc
attagcctaacagacgtaaaaggctctggcgagaatggccgtattgtattgcgcgacgtg
gagaactttaccccatctgccgctgcacctagaacacaagcaccagtggcttctgcccct
gctacgcctgccgctccggtagctgcgccaggcgaagcctattcagaggtgctggtgtct
cagatgcgcaaaatcattgctaaacgtctagccgaaagcaaattctctgcgccgcacttc
tacctgaccatggagattgacatggacagagccatggaagcccgcgtgagtatcaatgaa
gtgtctccggtgaaagtgtcgttcaatgatctggtcattaaagccgccgccgccgctttg
cgcaagcaccctgccgtgaactcatcgtggttaggcgataagatccgttacaacaacgtc
atcaacattggcgtggcggtagcggtagaagatggtcttttagtaccagtggttcgcaac
gctgaccaaaagactctttctgctatctctgcggaagtgaaggacctgggcggaaaagcc
aagagcaagaaacttcagccgtcagactgggaaggcaacaccttcaccatctctaaccta
ggcatgtttggcattgaagagttcaccgccatcatcaacccaccagatgcgtgcatcctg
gccgtgggtggcatcaagcagacgccggtggtgaagaacggtcagattcaaattggcaac
attatgaaagtgaccttgtcctgtgaccaccgagtggtggacggcgccgtgggctctgcc
ttcctgcagaccttgaaaggcttcctggaagacccggtgagaatgttagtgtaa

DBGET integrated database retrieval system