KEGG   Ruegeria sp. NKC1-1: DT065_06250Help
Entry
DT065_06250       CDS       T05571                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00061  Fatty acid biosynthesis
rue00780  Biotin metabolism
rue01100  Metabolic pathways
rue01130  Biosynthesis of antibiotics
rue01212  Fatty acid metabolism
Module
rue_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rue00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DT065_06250 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DT065_06250 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DT065_06250 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rue01004]
    DT065_06250 (fabI)
Enzymes [BR:rue01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DT065_06250 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DT065_06250 (fabI)
Lipid biosynthesis proteins [BR:rue01004]
 Fatty acid synthase
  Component type
   DT065_06250 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AXF55661
UniProt: A0A345BXI0
LinkDB All DBs
Position
complement(1238368..1239150)
Genome map
AA seq 260 aa AA seqDB search
MSLSLEGRTYVVMGVANKRSIAWGISRRLAEAGANIVFTYAGERLGKNVRELAGTLETET
FVYPCDITNDEEIDATFRQIKDEVGTIHGLAHCIAYAKKEDLEGSFVETSREGFKVAHDI
SAYSLIAVANAVQKNDMMAENGSIMTMTYLGGERVVKNYNVMGVAKAALDANVRYLANDL
GQHGIRVNAISAGPIRTLSAKGVADFNSSLKEMEEKAPLKRGVTQEEVGDTALFLMSDLS
KGMTGETLHVDGGYHIIGLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatctttggaaggacgcacctatgtcgtgatgggtgtggcgaacaaaagaagc
attgcctggggcatctcccggcgtctggcagaagccggagcaaacattgtatttacatat
gccggtgaacgtctcggaaaaaatgtccgtgaattagcgggcacattagaaacagaaacc
tttgtatatccatgtgatattacgaacgacgaggaaatcgacgctacttttcgtcaaatc
aaagatgaagtgggcacaattcacggattggcccattgcatcgcgtatgcaaaaaaagaa
gaccttgaaggctcgttcgtggagacatcgcgggaagggtttaaagttgcgcatgatatt
agcgcttattcgttgattgctgtggcgaatgccgtgcaaaaaaatgacatgatggcagaa
aacggctcgatcatgacgatgacgtatctcggcggcgaacgcgtcgtgaaaaattataac
gtgatgggggttgcgaaagcggcgttggatgcaaatgtccgctacctcgcgaacgacctt
ggccagcatggcatacgagtaaatgccatttccgccggtccgatccgtacgctttctgcc
aaaggcgtcgccgattttaacagttccttgaaggaaatggaagaaaaagcgccgttgaaa
cggggagtcacccaagaagaagttggtgacaccgcactctttttaatgagcgatttgtca
aaaggtatgaccggagaaacgctccatgtcgacggaggttatcacatcatcggtttgggg
taa

DBGET integrated database retrieval system