KEGG   Ruegeria sp. NKC1-1: DT065_09755Help
Entry
DT065_09755       CDS       T05571                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00340  Histidine metabolism
rue01100  Metabolic pathways
rue01110  Biosynthesis of secondary metabolites
rue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DT065_09755
Enzymes [BR:rue01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     DT065_09755
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     DT065_09755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AXF56273
UniProt: A0A345BZ92
LinkDB All DBs
Position
complement(1920678..1921304)
Genome map
AA seq 208 aa AA seqDB search
MNVDDIVFDADGLIPAVVQDVNSKEVLTVAYMNRESLQKTIDTKETWFYSRSRQTLWHKG
ETSGNVQRVSDLRYDCDRDALLVLVHPQGPACHHGTYSCFTESLLSEERTQESNDFTIVR
TVAATIAERNHERPEGAYTTYLFEEGVDKILKKIGEEASEIIIAAKNRDGEELAWESADF
IYHLLVLLEEQQLSFDDVLDTLRERHGK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggatgacatcgtttttgatgccgacggattgatcccggcggtcgttcaggat
gtgaacagcaaggaagtgctgaccgtggcgtatatgaaccgggagtcgttacagaaaacg
atagatacgaaggaaacctggttttatagccgttcgcgccaaaccctctggcataaaggc
gaaacctcaggaaatgttcagcgagtgagcgatcttcgttatgattgcgaccgtgatgcc
ctcctcgtgctcgtgcacccgcaaggtccagcgtgtcaccacggaacatacagctgtttt
acagagagccttctctccgaagaacggacgcaagaatcaaatgattttacgattgtgcga
accgtagccgcaacgattgcagaaagaaatcacgagcgccccgagggcgcttacaccacg
tatttatttgaagaaggcgtggataaaatcttaaaaaaaatcggcgaagaagcttccgaa
atcattatagcggcaaaaaaccgggacggagaagaactggcttgggagagcgccgatttc
atttatcatcttctcgtgttgcttgaagagcagcaattgtcctttgacgatgtgttggat
acgttaagggagcggcatgggaagtaa

DBGET integrated database retrieval system