KEGG   Salicibibacter kimchii: DT065_12175
Entry
DT065_12175       CDS       T05571                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase 2 family protein
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
rue  Salicibibacter kimchii
Pathway
rue03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rue00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DT065_12175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rue03400]
    DT065_12175
Enzymes [BR:rue01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     DT065_12175
DNA repair and recombination proteins [BR:rue03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DT065_12175
SSDB
Motif
Pfam: HhH-GPD OGG_N AlkA_N aGPT-Pplase1
Other DBs
NCBI-ProteinID: AXF56695
UniProt: A0A345C0G4
LinkDB
Position
complement(2391429..2392331)
AA seq 300 aa
MHWEDRQDHLRMFTPDAFSFKENVGYLARSADECMFEIKDEKIYRALALQNETVLIEISA
ESDQVLVVHFLAGTAPKYQENRAEVARYIWDWFDLDTDLQPFYALAKKDPLLHEPVAKFY
GLRNVGLPDLFEALAWGILGQQINLSYAYTLKRRFVETFGKKKGNYWLFPRPETIAKQQV
EDVATLKMTKKKAEYLIDVADRIAKGALSKEQLLAAESFKDAEKMLTNIRGIGPWTANYV
LMRCLRYPSAFPIDDVGLQNAFKLMLGYDEKPSKEEILQYAANWKGWETYATFYLWRMLY
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcactgggaagatcgccaggatcatctgcgaatgttcacaccggatgcgtttagtttt
aaagagaatgtgggctatttggcaaggtcggcggatgaatgcatgtttgaaatcaaagat
gaaaaaatatacagggcgttggcattgcaaaatgaaacggtactcattgaaatcagcgcg
gagagcgatcaagtgctcgtcgtccacttcctcgcggggaccgccccgaaatatcaagaa
aatcgagccgaagtcgcccgttacatttgggactggtttgatctggacactgaccttcaa
cctttctatgcgttagcgaaaaaagacccattactgcacgaacccgtcgccaaattttac
ggattgcgaaatgttggactcccagatttattcgaagctttggcgtggggcatattgggc
cagcaaatcaacctttcctatgcctatacactgaagcgccgtttcgtggaaacattcggg
aagaaaaaagggaattattggcttttcccccgcccggaaacaatcgcgaaacagcaagtc
gaagatgtcgccactttaaaaatgacaaagaaaaaagccgaatacctcattgatgtcgcg
gatcgcatcgccaaaggagcgttatccaaagaacaactactcgcggccgagagctttaaa
gatgctgaaaaaatgctcaccaacattcgcggcatcggtccctggacggccaattacgta
ttaatgcgttgtttacgttacccatccgcctttcccatcgatgatgttggtttgcaaaat
gccttcaaactgatgcttggatacgacgaaaaaccctccaaggaagaaatcctgcaatac
gcggcaaattggaagggctgggagacttacgccaccttctacttgtggcggatgctgtat
tga

DBGET integrated database retrieval system