KEGG   Ruegeria sp. NKC1-1: DT065_15925Help
Entry
DT065_15925       CDS       T05571                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00473  D-Alanine metabolism
rue01100  Metabolic pathways
rue01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DT065_15925 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DT065_15925 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rue01011]
    DT065_15925 (alr)
Enzymes [BR:rue01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DT065_15925 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rue01011]
 Precursor biosynthesis
  Racemase
   DT065_15925 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AXF57342
UniProt: A0A345C2B1
LinkDB All DBs
Position
3153911..3155047
Genome map
AA seq 378 aa AA seqDB search
MDTHSVNQYRDTWIEIDVKAIASNVKSVKTLHHPDVNVMAVVKADGYGHGAVTVARTALE
SGADWLGVALLEEAVELRNAGVDAPILVLGPINPQDASVAQHYRISITAFQSEWLAEASP
HLDPESALHVHLKCDTGMGRIGLTDEQTLLDMLKMLKSDKRFTFTGIFTHLATADEWGSE
YLSRQLKAFQSYVQLAKEVAGPIPYIHYSNSAASLRYPGNDYNMVRFGISMYGLVPAVET
ATDIPVSLKPAMSLHSRLTHVKKVQPETSISYGATYQASEEEWIGTVPIGYGDGWLRANA
TNGGEVLVKGQRCPMVGRICMDQMMIRLPSEIPVGTKVTLIGKQKHEEISIEEVSERLST
ITYEIPCLLNGRIPRVNI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtggacactcacagcgttaatcagtatcgagacacttggatagaaatcgatgtaaaagca
attgcaagcaatgtcaaatcagtaaaaacgcttcatcatccggatgttaacgtcatggca
gtcgtgaaagcggacgggtatggccatggcgcggtgaccgttgcccggacggcactcgaa
tcaggagcggattggcttggggtagcgcttttggaagaagcggtggaactaagaaatgca
ggcgtagacgccccaattttagtgctcggtcctattaaccctcaagatgcttcggtcgcc
caacactaccgtatttcaattacagcttttcaaagcgagtggctggcggaggcgagccct
catcttgatccggagtcagctctacacgtgcacctgaaatgtgatacggggatggggaga
attggattaacggatgaacagaccttgctggatatgctaaagatgctgaagtcggacaag
aggtttacgttcaccggaatttttacgcacctggcaactgcagatgaatggggaagcgag
tacttatcccggcaattaaaagcttttcaatcatatgttcagttggccaaagaagtggcc
ggacccatcccttatattcattacagcaatagtgccgcgagtttgcggtacccgggaaac
gattataatatggttcgttttggtatctcgatgtatggccttgtccccgctgtcgagacc
gcgacggatattccggtttctttaaagccggcgatgtccctgcatagtcgcttgacacat
gtaaaaaaagtacaaccggaaacgtccataagttatggcgccacgtatcaagcaagcgaa
gaagaatggatcggaacggtaccgatcggctatggggatggttggttaagggcgaatgca
acaaacgggggggaagtgcttgtgaaagggcaacgctgtccaatggttggtagaatatgc
atggatcaaatgatgataaggcttccctcggaaatcccggtcggaacaaaagtgacttta
atcggaaaacagaaacatgaagaaatcagcatagaagaagtatcggaacgtctctccacg
atcacgtatgaaattccctgcctattgaacggcaggattccccgtgtaaatatatga

DBGET integrated database retrieval system