KEGG   Ruegeria sp. NKC1-1: DT065_17175Help
Entry
DT065_17175       CDS       T05571                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00970  Aminoacyl-tRNA biosynthesis
rue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rue00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DT065_17175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rue03029]
    DT065_17175
Enzymes [BR:rue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DT065_17175
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DT065_17175
Mitochondrial biogenesis [BR:rue03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DT065_17175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF848
Motif
Other DBs
NCBI-ProteinID: AXF57545
UniProt: A0A345C2W4
LinkDB All DBs
Position
3381800..3383299
Genome map
AA seq 499 aa AA seqDB search
MDNLKCHLSWTKGVKAVSFLDETIASMQQKIKNKEVKVSELTESAYKRIRDVDDSVQAFL
TLDEEGAMEKARALDEQVNQSEGQPLFGIPAGIKDNIMTEGLKTTCASQLLDNFNPVYDA
TVMKHLHAQNTITVGKLNMDEFAMGSSNENSGYFGTKNPWDTNYVPGGSSGGSAAAVAAG
EVPFALGSDTGGSIRQPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAY
VLQEIAGHDENDSTSVDVSVPDYRSALEGNINGLRIAVPKEFLEEGVDAGVKERIQTAIR
TLEGMGATCEEVSLPNSRYAVAAYYLLSSSEASAHLARFDGIRYGVRKGGDDLMDVYKKT
RSEGFGDEVKRRIMLGTFALSTGYYDAYYKKAQKVRTLIREDFNQVLHSYDVILGPTAPT
PAFKIGEQKDDPLTMYLNDILTIPVNLSGNPALSIPCGFSNGLPVGMQLIGKPFEERILY
RVGHAYEQETGHYKEKPGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacaatttgaagtgccatctgtcctggactaaaggagtgaaagccgtgtcatttttg
gatgaaacgatcgcatcgatgcaacagaaaataaaaaataaagaagtaaaagtctcagag
ctgaccgaaagtgcctacaaaagaattcgagacgtcgatgattcggtgcaggcatttctc
accttggatgaagaaggcgccatggagaaagcccgagcgcttgatgaacaggtcaatcaa
agcgagggacaaccattgttcggcattccggcaggcattaaggacaacatcatgaccgag
ggattgaaaacgacatgcgccagtcaattgcttgataattttaaccccgtctatgatgca
acggttatgaaacacttgcacgcacaaaataccataaccgtcgggaaattaaacatggac
gagttcgcgatgggctcttccaacgaaaattccggctattttggaacgaaaaacccgtgg
gatacgaactacgtgcccggaggttcaagcggagggtccgctgccgcggtcgccgcggga
gaagtgccgtttgcattaggatcggacaccggaggatccattcgacagcccgcgtctttt
tgcggagtggtcggcttgaagcctacatatggacgagtatcgcgttacggacttgtggca
ttcgcttcttcattggatcaaatcggtccgattacccgaaccgtcgaagataatgcctat
gtgcttcaggaaattgcgggccatgacgagaacgactccacatccgtggatgtgtccgtg
ccggattatcggtcagcacttgaaggcaacattaacggtttgagaattgcggtaccgaaa
gagtttcttgaggaaggggtcgacgccggcgtcaaagaacgcattcaaacggcgattcgc
acattggaaggaatgggggcaacatgcgaggaagtgtccttgcccaattccaggtacgcg
gttgctgcttattatttgctctcttcttcggaagcctccgcccatcttgcccgttttgac
ggtatccgttacggcgttcgaaaaggcggcgacgatttaatggatgtctataaaaaaaca
agaagcgaaggctttggcgatgaagtgaagcgccggattatgctgggaacattcgcgctt
agcactggatattacgacgcttactataaaaaagcgcaaaaagtgcggacgctgattcgc
gaagatttcaaccaggtgttgcatagttatgacgtgattcttgggccgacggcaccgaca
ccagcgtttaaaatcggagaacaaaaagatgatccgcttacgatgtaccttaatgatatt
ttgaccattccggtcaacctgtccggaaacccggccctatccattccgtgcggtttttca
aatgggctcccggtcggaatgcagttgatcggaaaaccatttgaagagcgcattctttac
cgtgtcggtcatgcttacgaacaagaaacaggacattataaagaaaaaccgggactataa

DBGET integrated database retrieval system