KEGG   Ruegeria sp. NKC1-1: DT065_18355Help
Entry
DT065_18355       CDS       T05571                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rue01100  Metabolic pathways
rue01110  Biosynthesis of secondary metabolites
rue01130  Biosynthesis of antibiotics
rue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DT065_18355
Enzymes [BR:rue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     DT065_18355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: AXF57740
UniProt: A0A345C3F9
LinkDB All DBs
Position
3589113..3589994
Genome map
AA seq 293 aa AA seqDB search
MEKIAYLGPEGTFSELAATAFTKSAERLPYRDISSCLQALAKKEVDGAVVPLENTIEGSV
NITLDHLVHKHDLPIVGELAIPVAQHLLVHPQNADQSMGIVYSHPHALAQCHDYLSKHLS
GAEWMHASSTAKAAKEIAENPSLNRAVIANRLAAKTYGLAITAENIHDFANNHTRFVLLS
TRKTQNDPSVEARPSVNRKTTIVVTLPSDYSGALHQVLSAFAWRKLNLSKIESRPMKTGI
GHYFFIIDIDHAYDDVLVPGALEEIKAIGCATRLLGSYPSAVIHEENEMESTI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaattgcatatttaggccctgaaggtacattcagtgaattagcagccactgct
ttcacaaaatcggctgagcgtctcccatacagagacatttcgagttgcttgcaggctctc
gcgaaaaaagaagtagacggtgcggtcgtcccattggaaaatacgattgaaggatcggtt
aatatcacgcttgatcacctcgtgcacaagcatgaccttccgattgtcggcgaattggca
atcccggttgcccagcatttgctcgtacaccctcaaaatgccgatcaaagcatgggaatt
gtgtattcgcaccctcacgcgctcgcgcaatgccacgattatctgtccaagcatttgtca
ggtgccgaatggatgcacgcgtcgtcaacagccaaagccgccaaagaaatcgccgaaaac
ccaagcttgaatcgagcggtcattgccaaccgactggctgctaaaacatacggacttgct
ataactgctgaaaacattcatgactttgcaaataaccatacccgttttgtgcttctttcc
acgagaaagacgcagaacgatccatccgtggaggcgcgaccaagtgtaaatagaaaaacg
accattgtcgtaacgcttccctcggattattcgggcgcgcttcatcaagtattatccgca
tttgcatggcgcaaactcaacctttccaaaatcgaatcaagaccgatgaaaaccggaatc
gggcattattttttcattattgatattgatcatgcatacgatgacgtattggtccccggg
gcgcttgaagaaatcaaggccatcggatgtgcaacccggttactcggttcatacccatcg
gccgttatccatgaagaaaatgaaatggaatcaactatataa

DBGET integrated database retrieval system