KEGG   Ruegeria sp. NKC1-1: DT065_18415Help
Entry
DT065_18415       CDS       T05571                                 

Gene name
spoVB
Definition
(GenBank) stage V sporulation protein B
  KO
K06409  stage V sporulation protein B
Organism
rue  Ruegeria sp. NKC1-1
Brite
KEGG Orthology (KO) [BR:rue00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rue02000]
    DT065_18415 (spoVB)
Transporters [BR:rue02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   DT065_18415 (spoVB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MatE MurJ
Motif
Other DBs
NCBI-ProteinID: AXF57751
UniProt: A0A345C3H0
LinkDB All DBs
Position
complement(3599226..3600779)
Genome map
AA seq 517 aa AA seqDB search
MTRQTFFAGAFILIIAGLITRVLGFINKIVMARVMGSEGMGLYMMAVPSLLLIITLTQLG
LPVAISKLIAEAEAHGEHERKKRILVISLIVTGTLSAVLTTAMIAAAPFLASFLLTDTRA
LYPLLAIIPIVPIVALSAVLRGYFQGMQNMRPIAFSQVIEQVIRIALVAFCTSIFLPFGV
EYAAAGAMISVVAGELASLVYVIYVFKNKKTMRIRKNFFSALNGGKRTLQDLMTIALPTT
GSRLVGSVSQFLEPIIVAQSLAIAGVATVTATSQYGELVGFVVPLLFLPSFITQSLSVSL
VPAISEAHSKGDHATIQKRLQQTTKVALLSGGISVVILYVFAVPILSLMYDAPQAAVYLK
VIAPFCIFLYFQMPLQSVLQALNLAKAAMYNSLIGAGVKMTAIALLASRPELGIMGLALA
ICASLMVVTLLHFISVSRAIGFTLKVKDWTGTLLVSLLTAGVAVHSFRTFISTDDLLVGT
IISLTITVVFYLIGLVLFRLLPIKNISQIPILQSFFR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcagacgtttttcgcaggtgcttttattcttattatcgcagggttaatcacc
cgtgtcctcgggtttattaataaaattgtcatggccagggtgatggggtccgaaggtatg
gggctctatatgatggccgttcccagcctgttactcatcattacgcttacccaactcggt
cttccggttgcgatttccaaattgatcgcggaagcagaagcccacggcgaacatgaacga
aaaaaaagaattctggttatttcccttatcgttaccggtacattaagtgctgtgttaacg
acagcgatgatcgcggctgcaccatttctggcgagtttcttgttaacggacacccgagcg
ctctatcccttgcttgctatcatcccaatcgtcccgattgttgccctttccgcagtgtta
aggggatactttcaagggatgcaaaacatgcgcccgatcgctttttcccaagtgatcgag
caagtcatccgaatcgccctcgtcgccttttgtacgagcatctttttgccattcggagtc
gaatatgctgcagcgggggcgatgatatcggttgtcgccggtgaattggcatcgttagtc
tacgtgatttacgtgtttaaaaataaaaaaacgatgcgcatccggaaaaacttcttctct
gccctgaatggcggaaaaaggactttacaagatttaatgacgattgcgctacccacgaca
gggagccggcttgtcggatcagtctcccagtttctggaaccgatcatcgtcgcccaaagc
ttggcaattgccggagtagcaactgttacagctacgagccaatacggggaattggtcggt
tttgtcgttccccttctttttctgccttcgtttattacgcaaagtttatcggtctcactc
gttccggctatcagtgaggcccatagcaaaggcgatcatgccaccattcaaaaacggtta
caacagacaacaaaagtggccctgctttccggcggtatttccgttgttatcttgtacgtg
tttgccgttccgatcctatcacttatgtatgacgctccacaagccgccgtgtacttaaaa
gtgatcgctcccttttgtatctttctttattttcaaatgccgctgcaatccgtgttacaa
gcgttaaatttggcaaaagcggctatgtataacagcctcatcggtgcaggggtgaaaatg
actgccattgccttattggcctctcgtccggaacttggcatcatggggttggccctcgcg
atttgcgccagtctaatggtggtcacccttcttcattttatcagtgtctcaagagcgata
gggttcacattaaaagtgaaagactggaccggcacattacttgtcagcctattgaccgcg
ggagtcgccgtccattccttccgcacgtttatttcaaccgatgacttgctcgtcgggacc
attatcagcctaacgattacggttgtcttttacttgattgggttagttttgttccgtctt
ctccctattaagaatatcagccaaatcccaattcttcaatctttctttcgttaa

DBGET integrated database retrieval system