KEGG   Ruegeria sp. NKC1-1: DT065_18425Help
Entry
DT065_18425       CDS       T05571                                 

Gene name
secD
Definition
(GenBank) protein translocase subunit SecD
  KO
K12257  SecD/SecF fusion protein
Organism
rue  Ruegeria sp. NKC1-1
Pathway
rue02024  Quorum sensing
rue03060  Protein export
rue03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rue00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    DT065_18425 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DT065_18425 (secD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DT065_18425 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rue02044]
    DT065_18425 (secD)
Secretion system [BR:rue02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   DT065_18425 (secD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF MMPL ACR_tran Sec_GG
Motif
Other DBs
NCBI-ProteinID: AXF57753
UniProt: A0A345C3H2
LinkDB All DBs
Position
3601350..3602654
Genome map
AA seq 434 aa AA seqDB search
MGKKWGRIGAFFAIIIALGVLISQTAFDVARGTNLGLDLQGGFEVLYELEPDSERELTDE
DIQATASALNERVDVLGVSEPSITVEGEDRIRVQLPGVEEQEEARELLSTEAELSFRDVD
DELMLTGEDLQQGGASTGFDDANQPIVQVTLEDSELFGEITSEISQRPEPENLLVIWLDY
DEDEHSFYEEANEPDPAFISAPRVSEPLPTDTVSIEGMGSLEEAEFLAEMLNAGSLPVQI
EEIYSNTVGASLGEQALEQTLFAGMIGVALIFLYMIAYYRFMGVIASLTLGIYIYLVMIL
FNSIQGVLTLPGIAALILGVGMAVDANILTYERIKEELKDGRSMKSAYKLGSGRALGTII
DANITTLIAAGVLFYFGTSAVQGFAVMLIVSILTSFITSVYGTRLLLGLWINSRTLNRKY
WLFGVKERDVRRGL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaatggggaagaatcggagcgtttttcgctattatcattgcgctcggtgta
ttaatttcacaaacggcattcgatgtggctcgaggtacaaatcttggccttgatttgcaa
gggggatttgaagttctgtatgaacttgaaccggatagtgaaagagaattaacggacgaa
gatattcaggcaactgcttcggcactgaacgaacgggtcgacgtgctcggggtttcggag
ccatccattacggttgaaggagaggaccgtatacgggtgcagctcccgggcgttgaagag
caggaagaagctcgcgaactcttgtccaccgaagcagaactatcgtttcgcgatgttgat
gatgagttaatgctaaccggggaagatctacagcagggtggggcgagcacgggttttgat
gatgcgaatcaaccgattgtgcaagttacgttggaagacagtgagttgtttggagaaatc
accagtgaaataagccaacggccggaaccggagaatttactcgtcatttggctcgactat
gatgaagatgaacattctttctatgaagaagccaatgagccggacccggccttcatttca
gcacctcgggtaagcgaaccacttcccacggacactgtttccattgaaggcatgggttcc
cttgaagaagccgaatttttggctgaaatgctcaatgccgggtcgcttcctgtccaaatc
gaggaaatctactccaacacggtaggggcatctttgggagagcaggcattggaacagaca
ttgttcgcgggcatgatcggtgtggctctgatctttttatacatgatagcttattaccgt
tttatgggtgttattgcctctcttacactagggatatatatctacttggtgatgatcctc
tttaattccatccaaggggtgctgaccttgcccggcattgccgctttaattctcggagtc
gggatggcggtggatgccaatattttaacgtacgagcgcattaaagaagaattaaaagat
ggaaggtccatgaaatccgcgtataaattgggaagtgggcgcgcgttggggacgattatt
gacgccaacattacaacactcatcgcagcgggagtgcttttctacttcggtacgagcgcg
gtacaaggatttgccgtcatgctcattgtcagcatattgacgagctttattacctcggtg
tatggcacacgactcttgctcgggctatggattaacagtcgaactttaaatcgtaaatat
tggctgtttggcgtaaaggagcgtgatgttcgccgtggactttaa

DBGET integrated database retrieval system