KEGG   Rufibacter sp. DG31D: TH63_03090Help
Entry
TH63_03090        CDS       T03996                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ruf  Rufibacter sp. DG31D
Brite
KEGG Orthology (KO) [BR:ruf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TH63_03090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ruf03400]
    TH63_03090
Enzymes [BR:ruf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TH63_03090
DNA repair and recombination proteins [BR:ruf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TH63_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKQ44835
UniProt: A0A0H4VGU1
LinkDB All DBs
Position
724570..727143
Genome map
AA seq 857 aa AA seqDB search
MSLKEYNQKRHFNQTPEPEGKGAKNKGDLKFVVQRHQASTLHYDFRLELDGVLKSWAVPK
GPSLNPADKRLAMEVEDHPFSYRTFEGDIPEGNYGAGHVDIWDEGTFHAVDNPSRAEGEK
LMLQELEAGSLHFVLEGKKLKGEFALVKMKGRQKNAWLLLKKQDEFATDAYDAEDFARGG
GAVKPGKVPAKKASTAKEKASPAKAQTGKGKKGEMPHDIVPMTAKLTDGPFDDENWLFEM
KWDGYRAVAEVDNGQVRLYSRNGKSFKQKYAPVVQVLEGLKHQAIFDGELVVLGANGRAD
FQALQNYQNTPSEHLYYYIFDLLYLNGQDLTKVPLLRRKELLAEVLKGAKEPLRYSEHRV
GKGIAFFKEAQQHHWEGIMAKAADSKYHIGKRSQEWLKIKTHLRQEAVIAGFTEPKGSRI
HIGALVLGVYEGKELKYVGQSGSGFNKESLEDLKARLAPLVQEKSPFKVKVGLSRDVTWV
KPELVCELSFAEWTTDGQMRQAIFEGLRVDKKAKDVVHEHAIATPPEADAKEESSKGAKK
TKTMSKQEEEKEGLVLHLDGKDVAISSPDKLYWPEEGITKKDLVEYYQSMAEVLLPYLKD
RPESLLRHPNGITKPGFFQKDAGDHAPDWVQKESIRAESTGQDVNYVVCQDKATLAYLNN
LGCIQLNPWNSRLQHLEHPDYLVLDLDPGENTYDEVVETALVAKQVLDELEIPVYAKTSG
ATGMHLYVPLAAKFPFEQVKELAYALAQRVHARLPKLTSLERSPKERRNQIYIDFLQNAI
AQTIAAPYCVRPKAGATVSTPLQWKEVKTGLHPSQFTIKNVPQRVKKLGDIFMPVLGEGI
DVATYLKRLKQEDHGKK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaagaatataaccagaaacggcacttcaaccagactcctgagcccgaaggc
aaaggggcaaaaaacaaaggcgacctcaaatttgtggtacagcggcaccaggcttctacg
ctacattatgatttccggctggagctggacggcgtgcttaagagctgggctgtgcccaaa
ggcccctcgcttaaccccgcagacaaacggctggccatggaagtggaagaccaccccttc
agttaccgcacatttgagggagacatccccgaagggaactatggcgccggccacgtggac
atctgggacgaaggcaccttccatgccgtagacaacccttcccgcgcggaaggtgaaaaa
ttaatgctacaggagctagaggccgggagcctgcactttgtgctggaaggcaagaagctg
aaaggcgagttcgcgctggtgaaaatgaaaggccgccagaaaaacgcctggctgctcctc
aaaaagcaggacgaatttgccacggatgcctatgacgccgaggatttcgccaggggcgga
ggggctgtaaaacccggaaaagtgccggcaaaaaaagcgtctacggctaaagaaaaagct
tctccagccaaagcccagacaggcaaaggtaaaaaaggcgagatgccccatgacattgtg
cccatgaccgccaaactcaccgacggcccttttgatgacgagaactggctgtttgagatg
aaatgggatggttaccgggcagtggcagaggtagacaacgggcaggtgagactctattcc
cgcaatggcaagtcctttaagcagaagtacgcccccgtggtccaggtactggaagggctt
aagcaccaggccatttttgacggcgaactggtggtgctgggcgccaatggccgcgccgat
tttcaggctttgcagaattatcagaatactccctcagagcacctgtattactacattttt
gatttgctgtacctcaacgggcaagaccttaccaaagtaccgctgttacggcgcaaggag
ttgttggcagaggttctcaagggggccaaagagcctttgcgctatagtgagcatagggta
ggcaagggtatagctttcttcaaagaggcccagcagcaccattgggaaggcattatggcc
aaagcggcagacagcaaataccatataggtaagcggtctcaggagtggctgaagatcaaa
acccacctgcgccaggaggctgtgatagccggtttcaccgagcccaagggcagccgcatc
catattggggcgctggttctgggcgtatatgagggcaaggaattgaaatacgtgggccag
agcggcagcgggttcaacaaagaaagcctggaagacctgaaggccagactagcaccgctg
gtgcaggaaaaatcgccgttcaaagtcaaggtaggcctttcccgtgacgtgacctgggtg
aaacccgaactggtctgcgaactctccttcgcggaatggaccacggacggacagatgcgc
caagccatttttgagggcctgcgggtagataagaaagccaaagatgtggtgcatgagcac
gccattgccactcccccggaggcagatgcaaaagaggaatcctcaaaaggggctaaaaaa
accaaaacaatgtcaaaacaggaagaagagaaagaaggcctggtactgcacctggacggg
aaagacgttgccatcagcagccccgataaactgtattggcccgaggaaggcattaccaaa
aaggatttggtagagtattaccagtccatggccgaggtactgctgccttacctgaaagac
cgccccgaaagtctgctgcgccaccccaacggcatcaccaaaccgggcttcttccagaaa
gacgccggtgaccacgccccagattgggtacagaaagaaagcattagggcagagtctacg
ggccaggatgtcaattatgtggtttgtcaggataaggccacgctggcgtacctcaacaac
ctgggctgtattcagctcaacccctggaactcgcgcctgcaacaccttgagcacccagat
tatttggtgctggacctggaccccggcgagaatacttatgatgaggtggtggaaactgcc
ctggtagccaagcaggtgctggatgaactggagataccggtgtatgccaaaacctcaggt
gccacgggcatgcacctgtacgtgccgctggctgccaaattcccgtttgagcaggtcaag
gaactggcctatgccctagcgcaacgggtgcacgcccgcctgccaaagcttaccagcctg
gagcgcagccccaaagagcgtcgcaaccagatttacattgattttctgcagaacgccatt
gcccagaccattgcggccccttactgcgtccggcccaaggccggggctaccgtctccacg
cccctgcaatggaaagaagtgaaaaccggattgcacccttcgcagtttactataaagaac
gtgccccaacgcgtcaaaaagctaggcgatattttcatgcccgtgctgggcgaaggcatt
gatgtggccacgtacctgaaaagactgaaacaagaagaccatggaaaaaaataa

DBGET integrated database retrieval system