KEGG   Rufibacter sp. DG31D: TH63_04505Help
Entry
TH63_04505        CDS       T03996                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ruf  Rufibacter sp. DG31D
Pathway
ruf00620  Pyruvate metabolism
ruf00680  Methane metabolism
ruf01100  Metabolic pathways
ruf01120  Microbial metabolism in diverse environments
ruf01200  Carbon metabolism
Module
ruf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ruf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TH63_04505
  09102 Energy metabolism
   00680 Methane metabolism
    TH63_04505
Enzymes [BR:ruf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TH63_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKQ45061
UniProt: A0A0H4W3S9
LinkDB All DBs
Position
complement(1052405..1054981)
Genome map
AA seq 858 aa AA seqDB search
MDGSANSALQTYDKHVGLKFQLYNSLFTSLPFHRVEKTGVLLSIFLLHCEEGYEKGLSPA
EIIHTFFSQYTPYRSLQEQTDLLFRFVQYAERQVVLFDALEDASFREIHDMAGAGTLRHL
QAEVEQTQTQPQLREKLKDFSVRLVLTAHPTQFYPSEVLGIINDLSKALYNDNTAQVNSY
LRQLGKTPFFKNEKPSPYDEAVSLIWYLENVFYQAAGHIMSYLKSQFPDALSQQHPLIRL
GFWPGGDRDGNPFVTAEITLKVAEALRGSIIKSYYQDVRKLKRRLTFKGVLSELNTLEQK
LYNNLFLPGYKADITREDILAPLQKIKETLIKDHNSLFLNLAENLIRKVELFGLFFASLD
VRQDSSAHTEVLEAIAATAQALPQNYADLSPEEKIAALLSAHTTVDPTTLENELHRDTVQ
SMQAIKTIQAINGEEGSHRYIISHSTSALDVMEVYGLFLLSGWKPEALSVDIVPLFETID
DLRNAHDVMQALYTTEVYRQHLQRRGNIQTIMLGFSDGTKDGGYLMSNWSIYKAKEELSA
LAQQYELQVVFFDGRGGPPARGGGRTHQFYASMGPKIASKEIQLTIQGQTISSNFGTIDA
AQYNMEQLLHAGIRNALFMAKEATFTQEEEQLMQRLADASYQAYNTLKNNPNFLEYLNYA
SPLRYYAEANIGSRPSKRKPGKLNLNDLRAVPYVGSWSQLKQNLPGYYGVGSAMEKLEAE
GQWEAIEQLYQRSLFFRTLLGNCEMAMTKCFFPLTAFLAKHPQYGPLWNMIYKEFECTKK
YVLRLTGNSQLMEDKPVNLLSIQMRQRIELPLLTIQQFALTKIREMEEQDTNTQDKPIYE
KLVMRCSFGIINAERNSA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggatggttctgccaacagcgccctgcaaacctatgacaagcacgtaggccttaaattc
cagttgtacaacagccttttcacttccttgccttttcatagggttgaaaaaacgggcgta
ttgctgtctatctttttgctgcactgtgaggagggctatgaaaaagggctgagcccggcg
gagatcattcataccttctttagccagtataccccttaccgcagcctgcaggaacagacc
gatctgttgtttaggtttgtgcagtatgctgagcggcaagtggttttgtttgatgccctg
gaagacgcctcctttagggagattcatgacatggccggcgcaggtacattaaggcacctg
caggccgaggtggagcaaacccagacccaaccacagctgcgcgaaaagctgaaggatttc
tcggtgcggttggtgcttaccgcccaccccacacaattctaccctagcgaggtgctgggt
atcatcaacgacctgtctaaagccctttacaacgacaataccgcccaggtgaacagttac
ctgcgccagctgggcaagaccccgttcttcaaaaacgagaagccgtcaccgtatgatgag
gccgtgagtttgatctggtacctggaaaacgtcttttaccaggccgccggacacatcatg
tcttaccttaaaagccagttccccgatgccctttctcagcagcaccccttgatccggttg
ggcttctggccaggcggcgaccgggacggaaaccccttcgtgactgcggagatcaccttg
aaagtagccgaggcactgagaggcagcatcattaaatcttactaccaagatgtgcgcaaa
ctcaagcgccgccttacctttaaaggggtgctcagtgaattgaatacgctggagcaaaaa
ctctacaacaaccttttcctgcccggctacaaagccgatatcaccagggaagacattctg
gcacccctgcagaagataaaggaaaccctcatcaaagaccacaacagcctgtttctgaac
ctggcggagaacctgatcagaaaagtggagctgttcgggcttttctttgcgtcgctggat
gtacggcaggacagctcggcccacaccgaggttctggaagccatagcggccactgcccag
gccctgccccaaaactacgccgatctttccccggaagagaagattgccgccttgctttct
gcccatactaccgttgacccgaccaccctggaaaatgaactgcaccgcgacacggtccaa
tccatgcaggccataaaaaccatccaggccatcaacggagaggaaggcagccaccgctac
atcatcagccacagcaccagcgccctggatgtgatggaggtgtatggccttttcctgctc
agcggctggaaacctgaggccctttccgtggacatcgtcccgctttttgagaccattgat
gaccttcggaacgcgcatgacgtgatgcaggctttgtacaccaccgaggtgtaccgccag
catttgcaacggcgcggcaatatccagaccatcatgctgggtttctcagacggcaccaaa
gacggcggctacctcatgtctaactggagcatctacaaagccaaagaagaactgagcgcc
ttggcccagcaatatgaactgcaggtggtcttttttgacggccgcggaggcccacccgcc
cgcggcggtggaagaacccaccagttctacgcgtccatgggtccaaaaatcgccagcaag
gaaattcagctcaccattcagggccagaccatcagctccaacttcgggactattgacgcg
gcgcagtacaacatggaacagctgctgcacgcgggcatcagaaacgccttgttcatggcc
aaggaagccaccttcacccaggaagaggagcaactcatgcaacgcctcgccgatgccagc
taccaggcctacaacaccctcaagaacaaccccaatttcctggaataccttaactacgcc
agccctttgcgctactacgccgaagccaacattggcagccgcccgtccaagcgcaaaccg
ggcaaactgaacctcaacgacctgagggcggtgccgtacgtaggttcctggagccagttg
aagcagaaccttccgggctattacggcgtggggtcggccatggaaaaactggaagctgaa
ggccagtgggaagccattgagcaactgtaccaacgctccctcttcttccggacgctatta
gggaactgcgagatggccatgaccaaatgcttcttcccgctcacggcgttcctggccaag
cacccgcaatatggtcccctctggaacatgatctacaaggagtttgagtgcaccaaaaag
tacgtgctgcgccttaccggcaacagccagttaatggaagacaagcccgtgaacctgctc
tccatccagatgcgccaacgcattgaactacccctgctcaccatccagcagttcgccctc
accaaaataagggaaatggaggaacaggataccaacacacaagacaaacccatctacgag
aaactggtcatgcgttgctccttcgggatcatcaacgcagagcggaattctgcttag

DBGET integrated database retrieval system