KEGG   Rufibacter sp. DG31D: TH63_05605Help
Entry
TH63_05605        CDS       T03996                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ruf  Rufibacter sp. DG31D
Pathway
ruf00010  Glycolysis / Gluconeogenesis
ruf00020  Citrate cycle (TCA cycle)
ruf00620  Pyruvate metabolism
ruf01100  Metabolic pathways
ruf01110  Biosynthesis of secondary metabolites
ruf01120  Microbial metabolism in diverse environments
ruf01130  Biosynthesis of antibiotics
ruf01200  Carbon metabolism
Module
ruf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ruf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TH63_05605
   00020 Citrate cycle (TCA cycle)
    TH63_05605
   00620 Pyruvate metabolism
    TH63_05605
Enzymes [BR:ruf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TH63_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H gerPA DUF3597
Motif
Other DBs
NCBI-ProteinID: AKQ45228
UniProt: A0A0H4VIK7
LinkDB All DBs
Position
complement(1348855..1350573)
Genome map
AA seq 572 aa AA seqDB search
MAEIIRMPKMSDTMTEGVIASWLKKVGDSVKSGDVLAEVETDKATMELESYEDGTLLYIG
PKNGESVPVDGVLAIIGKEGEDISGLMAEAGGSAPAPAQAEAPKKEEAPAAEPKKEEPAQ
EAAPAAQPAAANVKAEVVRMPKMSDTMQEGTIVAWHKKVGDKVKSGDLLAEVETDKATME
LESYEDGTLLYIGVEAGASVQVDGILAIIGEEGADYKALLNGGGNTNPAQAGSQEQATRV
EEHKTEAQSQSGDGVNQAAGAPVPGQGTAPAAAGENQGRVLASPLAKKVAQEKGVSLSQI
KGSGENGRIVLRDVENFTPSAAAAPKAQAPQAAAPAAPAAAPAQAGEAFTEVPVTQMRKV
IARRLAESLFTAPHFYLTMEIDMDKAMEARVVMNEVAPVKVSFNDMVIKAAAAALRKHPA
VNSSWLGDKIRYNNVVNIGVAVAVEDGLLVPVVRNADQKSLSTISAEVKDLGGKAKTKKL
QPSDWEGSTFTISNLGMFGIDEFTAIINPPDACILAVGGIKQTPVVKNGQIQIGNVMKVT
LSCDHRVVDGAVGSAFLQTLKGFLENPVTMLV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcatccgaatgcccaagatgagcgacactatgaccgagggagtcattgcc
tcatggttaaaaaaagttggtgattctgtaaaatctggggacgttcttgccgaagtagag
accgataaggcaacgatggagttggagtcttatgaagatggcaccttattatatattgga
ccaaagaatggagaatctgtaccggtagatggcgttttggccattattgggaaagaaggc
gaagatatttctggcctgatggccgaggccggcggaagcgcccctgccccagctcaggcc
gaagcacctaagaaagaagaagcccccgcggccgagcctaaaaaagaagaacctgcccaa
gaagccgcccctgctgcccagcctgccgccgccaacgtgaaagccgaagtggtacgcatg
cctaaaatgagcgacaccatgcaggaaggcaccatagtggcctggcacaaaaaggtgggc
gacaaagtgaaatccggtgacctgctggccgaggtggaaaccgacaaagccaccatggaa
ctggagtcttatgaagacggaaccctgctgtacataggcgtagaagctggtgcctctgtg
caggtagatggtattctggccattatcggcgaagaaggagccgattacaaagctttattg
aacgggggcggcaacaccaacccagcccaagccggttctcaggaacaagccacccgtgta
gaagaacataaaactgaagcccagtcccagtcaggtgacggcgtgaatcaggctgctggt
gctccggtaccaggccagggcactgctcctgctgccgctggtgagaaccaaggccgcgta
ctggcttcaccgttagccaagaaagtagcccaggaaaaaggcgttagcctatctcagatc
aagggatctggcgagaacggccgcattgtgctgcgcgacgtggagaacttcaccccttct
gctgccgctgctccaaaagcacaggctcctcaggccgctgccccagcagcacctgccgca
gctccggcccaagctggcgaagccttcaccgaagttccggttacccagatgcgcaaggtg
attgcccgccgtctggcagaaagcttgttcaccgcgccgcacttctacctgaccatggaa
attgacatggacaaagccatggaagcccgcgtggtgatgaatgaagtagcgccagtaaaa
gtgtctttcaatgacatggtgattaaagccgccgctgccgccttacgcaagcaccccgcc
gtgaactcctcgtggttaggcgataagatccgctacaacaacgtggtgaacattggggta
gcagttgctgtggaagacggtctgttggtaccagtggtgcgcaacgccgaccagaagtct
ctgtctaccatctctgcggaggtgaaagacctgggcggaaaagccaaaacaaagaaactg
cagccctcagactgggaaggaagcaccttcaccatctctaacttgggtatgttcggaatt
gacgagttcaccgccatcattaatccaccagacgcctgtattctggccgtaggcggaatc
aagcaaacgccggtagtgaaaaacggacagatccagataggtaacgtgatgaaagtaacc
ctttcctgcgaccaccgcgtagttgacggcgccgtaggctccgccttcctgcagaccctg
aaaggcttcctggagaaccctgtgaccatgctggtttga

DBGET integrated database retrieval system