KEGG   Rufibacter sp. DG31D: TH63_14115Help
Entry
TH63_14115        CDS       T03996                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ruf  Rufibacter sp. DG31D
Pathway
ruf00240  Pyrimidine metabolism
ruf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ruf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TH63_14115
Enzymes [BR:ruf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TH63_14115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Zn_ribbon_SprT
Motif
Other DBs
NCBI-ProteinID: AKQ46502
UniProt: A0A0H4VRD1
LinkDB All DBs
Position
complement(3455293..3455886)
Genome map
AA seq 197 aa AA seqDB search
MFIEPRVGNRQQAHKRGWIEVICGSMFSGKTEELIRRLNRAKIARQRVEIFKPAIDTRYH
EEDVVSHNATSIRSTPIQFANDMLLLGSGCDVVGVDEAQFFDEAITEVCVQLANSGVRVI
VAGLDMDYLGKPFGAMPALMGVAEYVTKVHAICVQCGEIASYSFRNAASQEKVLLGETDS
YEARCRHCFQEGMKGKL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagaaccccgggtgggaaaccgccagcaagcccataagcgtggttggatagaa
gtgatttgcgggtctatgttctcggggaagaccgaagaattaatccggcggctgaaccgc
gccaagatagcccggcagcgggtagagattttcaagcccgccattgatacccgttaccat
gaagaggacgtggtctctcacaacgccacctctatccggtccacgcccatccagttcgcc
aacgacatgcttctgctgggcagcggctgcgacgtggtgggcgtagacgaggcccagttc
tttgacgaggccatcaccgaggtctgtgtgcaactggccaacagcggggtgcgcgtgatc
gtggccggcctggacatggactacctgggcaaacccttcggggccatgcctgccttaatg
ggcgtagccgaatacgtgaccaaagtacacgccatctgcgttcagtgcggcgaaatcgcg
tcctactccttcagaaacgccgcctctcaggagaaggtattgctgggcgaaaccgattcc
tatgaagcccgctgccgccattgtttccaggagggaatgaaagggaaattgtaa

DBGET integrated database retrieval system