KEGG   Rufibacter sp. DG31D: TH63_16285Help
Entry
TH63_16285        CDS       T03996                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
ruf  Rufibacter sp. DG31D
Pathway
ruf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ruf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    TH63_16285
Enzymes [BR:ruf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TH63_16285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKQ46833
UniProt: A0A0H4VNE6
LinkDB All DBs
Position
complement(4011430..4012701)
Genome map
AA seq 423 aa AA seqDB search
MSFQNTLAYAQEQDHADPLRYFKEHFHIPQHNGKDTVYLCGNSLGLQPKSARAALEEEMT
KWAELGVEGHFKGDNPWFTYHKPLSELSAALVGAKPEEVVIMNQLTVNLHLMLVSFYRPE
GKRFKILTEAGAFPSDQYALETQAKFHGYHPDEAILEIAPREGESTWRTEDILAAIAEHK
DELALVMLSGVHYYTGQVFDMAAITQAAHAAGVPCGFDLAHAAGNVPMQLHDWDVDFAVW
CTYKYLNSGPGGTSGVFVHERHAQNNDLPRFAGWWGHDQAQRFQMKKGFIPMAGAEGWQV
SNGQILPMAVHKASLQIFADAGIEKLRAKSEKLTGYLEFLIKELNQPKELLEIITPADPA
ARGCQLSLLVNQNGRQLFDTLMANGFILDWREPNVIRVAPTPLYNTFEDVYRFGQFLTAH
FQK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcaaaatactctcgcctacgcccaggagcaagaccacgctgacccgctacgc
tatttcaaagagcatttccatattccgcagcacaacggcaaagacaccgtgtacctgtgc
ggcaactcgttggggctgcagcctaagtcggctagagcggccctggaagaggaaatgacc
aaatgggccgagttgggcgtggaaggccatttcaagggcgataatccctggtttacgtac
cacaagccgctgtctgagctgtctgccgccttggtaggcgccaagcccgaagaagtggtg
atcatgaaccaactcaccgtgaacttgcacctcatgctggtgtctttttatcggccggag
ggcaagcggtttaagattttaaccgaggccggtgcttttccttcagaccagtacgccctg
gaaacccaggcgaagttccatggttaccacccagacgaggccattctagagatagccccg
cgcgaaggcgaaagcacctggcgcaccgaggatatcctggccgccattgccgagcacaaa
gacgagttggcgctggtcatgttgagtggcgtgcattactataccggccaggtgtttgac
atggccgccattacccaggcggcccacgcagccggcgtgccctgcggctttgacctggcc
cacgccgccggtaacgtgcctatgcaactgcatgactgggacgtggactttgccgtgtgg
tgtacctataaatacctgaactcgggaccgggcggcacctctggcgtatttgtgcatgag
cgtcacgcccaaaataatgacctgccccgttttgcaggctggtggggccatgaccaggct
cagcggttccagatgaaaaaggggttcattcccatggccggggccgaaggctggcaagta
tccaatggacagattttgcccatggccgtgcacaaggcttcgttacagatcttcgccgat
gccggaatagaaaagctgcgggccaaaagcgagaaactgactggctacctggagttcctg
attaaagagctgaatcagcccaaagagctgctggaaatcattaccccggcagacccggcg
gcccgtggctgccagctttccttgctggtgaaccagaacggccggcaactgtttgacacg
ctcatggccaatggctttatcctggactggcgcgagcccaacgtgattcgggtggcgccc
acgccgctctacaatacctttgaagacgtgtaccggttcgggcagtttctgacggcgcat
tttcagaagtaa

DBGET integrated database retrieval system