KEGG   Ruminococcus sp. JE7A12: E5Z56_05115Help
Entry
E5Z56_05115       CDS       T05998                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
Organism
ruj  Ruminococcus sp. JE7A12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox ADH_N_2 NAD_binding_3 AlaDh_PNT_C TrkA_N Pyr_redox_2 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: QCT06779
UniProt: A0A4P8XXA3
LinkDB All DBs
Position
1095559..1096614
Genome map
AA seq 351 aa AA seqDB search
MKNSEAILVTPKKFEIQECPVPEPKDNEILMKVEYVGMCGSDIHGFEFGPFIPPKDPNTK
IGLGHEVAGEVVKIGSKVTKFKVGDKVLIEPGVPDNTCEYCREGRYNICPGVDFMATQPN
YKGALTQYMTQPEEWTYHIPEGMSTLEGALVEPAAVGMHAAILGGAMLGKSIVILGGGTI
GLMVLQACKSLGATDITVVDVLNKRLELAKKLGASRVINGKEEDTVALLRSEELYGDHGV
DLVFEAAGSVFTAQQAVQIVARGGKIMMVGTQSKPVPIDFLKINREVTIQTSFRYCNNFP
QTIEAIASGKFNVKDMVTHIYDYKDVQQAFEDAIDPVKKADMVKGVVKVAE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattctgaagcaattttggtaactcctaagaagtttgaaatccaggaatgtcct
gttccggagccaaaagataatgaaatattaatgaaagttgaatatgtcggaatgtgtggt
tctgacatccatggttttgagtttggtccatttatcccacctaaagatcctaacacaaag
attggtctaggtcatgaggttgccggtgaagttgtaaagatcggctcaaaggttacaaag
tttaaagttggtgacaaggttcttattgaaccgggtgttcctgacaacacatgtgaatac
tgccgtgaaggtagatataacatttgcccgggtgtagattttatggcaacacagcctaac
tacaagggtgcattaacacagtatatgactcagccagaagaatggacatatcatattcct
gaaggtatgtcaacactagaaggtgctttagtagaacctgcagcagttggtatgcatgca
gcaattcttggtggtgcaatgcttggtaagagtattgttattcttggtggtggtacaatc
ggtttgatggtactacaggcatgtaagagtctaggtgcaacagatattacagttgttgat
gttcttaataagcgtcttgaacttgctaagaagttaggtgcttcaagagttatcaacggt
aaagaagaagatactgttgctctattaagatcagaagaattatatggtgaccatggtgtt
gacctagtatttgaagcagccggttctgtatttacagctcaacaggcagttcagattgtt
gctcgtggtggtaagattatgatggttggtactcagtcaaagccagtaccaattgacttc
ctaaagattaacagagaagttacaattcagacttctttccgttattgcaacaacttccca
cagacaatcgaagctattgcaagtggtaagttcaatgttaaggatatggttactcatatt
tacgattataaagatgtacaacaggcatttgaagatgctattgaccctgttaagaaggca
gatatggttaagggcgtagttaaagtagctgagtaa

DBGET integrated database retrieval system