KEGG   Hungateiclostridiaceae bacterium KB18: A4V00_07135Help
Entry
A4V00_07135       CDS       T04437                                 

Definition
(GenBank) DNA-binding response regulator
Organism
ruk  Hungateiclostridiaceae bacterium KB18
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DNA_ligase_IV
Motif
Other DBs
NCBI-ProteinID: ANU53821
UniProt: A0A1C7GPN1
LinkDB All DBs
Position
complement(1431418..1432104)
Genome map
AA seq 228 aa AA seqDB search
MAKILIVDDDTNICELLRLYIEKEGFEAAISNDGESALKKFDSFSPDLMLLDIMLPGLDG
WQVCREIRKKSSCPIIMLTAKGEVFDKVLGLELGADDYVVKPFETKEVIARINAVLRRSG
KGGDRLDNKEVSYENLVINLTNYELKVKGVQIDTPPKEMELIYHLASNPNRVFTRDQLLD
EVWGFDYYGDSRTVDVHIKRLREKLEGVSEKWSLKTVWGVGYKFEVKD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaattctgatcgttgacgacgataccaatatatgtgagcttctgcgactctat
atcgagaaggagggctttgaggcggccatctccaacgacggggagagcgcgcttaaaaag
ttcgacagcttctccccggaccttatgcttctggacataatgctccccggccttgacggc
tggcaggtctgccgggagatacgcaaaaaatcctcctgccccataatcatgctgaccgcc
aagggcgaggtgttcgacaaggtcctggggctggagctgggggccgacgactatgtggtg
aagccctttgagaccaaggaggtcatcgccagaataaacgccgtgctgcgccggagcggc
aagggcggcgacagactggacaacaaggaggtctcatatgagaacctggtgataaatctt
acaaactatgagctgaaggtgaagggcgtgcagatagataccccgcccaaggagatggag
cttatctatcacctggcctccaaccccaacagggtctttaccagggaccagcttcttgac
gaggtatggggctttgactattacggcgacagccgcacggtggacgtgcacataaaacgc
cttagggagaagctggagggggtttcggaaaagtggagcctgaagaccgtctggggcgtt
ggctataagtttgaggtgaaggactag

DBGET integrated database retrieval system