KEGG   Hungateiclostridiaceae bacterium KB18: A4V00_14245Help
Entry
A4V00_14245       CDS       T04437                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ruk  Hungateiclostridiaceae bacterium KB18
Pathway
ruk00473  D-Alanine metabolism
ruk00550  Peptidoglycan biosynthesis
ruk01100  Metabolic pathways
ruk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ruk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4V00_14245
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4V00_14245
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A4V00_14245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ruk01011]
    A4V00_14245
Enzymes [BR:ruk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4V00_14245
Peptidoglycan biosynthesis and degradation proteins [BR:ruk01011]
 Precursor biosynthesis
  Amino acid ligase
   A4V00_14245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: ANU55076
UniProt: A0A1C7GTF1
LinkDB All DBs
Position
2817302..2818378
Genome map
AA seq 358 aa AA seqDB search
MSNKLSLAVIFGGQSSEHEVSLMSAASILANLDREKYNIHQVGITKEGRWLLYEGPAEGL
SDGRWLRESTPAFLAPDPTVHGLVTLSEGGARTVHIDCVFPALHGKNGEDGSIQGLFELS
GIPYVGCRVTSSAVCMDKAIAHTLLSNTDINQAHYLWFYADRYRANSETVLNKIQARLDF
PVFVKPANAGSSVGVSKVERPEDLPAAIEKAANEDGKIIVEQGIDGQEVEVAVLGTRPGA
EASCVGEIGASAQFYDYDDKYINGTSQLFIPARLEEDVAQKVRETAVKAYRLLGCTGLAR
VDFFVTREDHRVVLNEINTLPGFTSISMYPKLWRHGGLTYAQLLDRLIELAFEEARNG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaagctttcccttgcggtaatcttcggcgggcagtcctctgagcacgaggtc
tcgctgatgtcggccgcttcaatacttgcgaatttagaccgggagaagtacaatatacac
caggtgggcataaccaaggagggacgctggctcctctatgagggtccggcggagggtctt
tccgacggccgctggctcagggagtccaccccggcgtttctggccccggaccccacggtg
cacggccttgtgaccctttcagagggcggcgcgcgcacggtgcatatagactgcgtgttt
ccggccctgcacggcaagaacggcgaggacggctctatacaggggctctttgagctctcg
ggcataccctatgtggggtgccgggtgaccagctccgcagtatgtatggataaggccata
gctcatactcttctgtcaaacaccgacataaaccaggcccactacctgtggttctacgcc
gacagataccgtgccaacagcgaaacggtgctcaataagatacaggcgaggctggacttc
ccggtgtttgtgaagcccgccaacgccggctcctcggtgggggtaagcaaggtggagcgc
cccgaggacctgcccgccgccatagagaaggccgcaaacgaggacggcaagataattgtg
gagcagggcatagacggccaggaggtggaggtggccgtgctgggcacccgcccgggggcc
gaggcctcctgcgtgggggagataggcgccagcgcccagttctacgactacgacgataag
tatataaacggcaccagccagctctttatccccgcccgcttagaggaggacgtggcccag
aaggtgcgggagaccgctgtaaaggcctataggctcctgggctgcacgggccttgcgagg
gtggatttcttcgtgacgcgtgaggaccaccgggtggtgctcaacgagataaacaccctg
cccggcttcacctctatcagtatgtaccccaagctctggaggcacgggggcctgacctac
gcccagctgctggataggcttatagagctggcttttgaggaggcccggaatggataa

DBGET integrated database retrieval system