KEGG   Ruminococcus sp. SR1/5: CK1_22090Help
Entry
CK1_22090         CDS       T02601                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenases
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
rum00040  Pentose and glucuronate interconversions
rum00051  Fructose and mannose metabolism
rum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CK1_22090
   00051 Fructose and mannose metabolism
    CK1_22090
Enzymes [BR:rum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CK1_22090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C TrkA_N NAD_binding_3 ThiF Shikimate_DH 3HCDH_N NADH_4Fe-4S AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: CBL20203
UniProt: D4LK42
LinkDB All DBs
Position
complement(1908694..1909746)
Genome map
AA seq 350 aa AA seqDB search
MIKKEKTIMLQQVMTNPGEIIFREVPVPEVKENQVLVKIMNIGVCGSDIHVYHGKHPFTK
YPVTQGHEVSGEITELGKNVTEFHVGQKVTIEPQVYCGHCYPCRHGKYNLCEELKVMGFQ
TTGTASEYFAVDASKVTPIPEDMSYEEGAMIEPLAVAVHGVKQMGDVAGMNIAVLGAGPI
GNLVAQAAKGMGAAKVMITDISDLRLAKAKECGIDVCVNTQNKDFGEAMIEAFGPDKADV
IYDCAGNNITMGQAIKYARKGSTIVLVAVFAGMAEVDLAVANDHELDIKSTMMYRHDDYI
DGIRLVNEGKVHLKPLISKTFAFKDYLKAYQYIDDNRETTMKVIINVSEK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaggagaaaacaattatgttacagcaggtaatgacaaatccaggagaaatt
attttcagagaggttccggttccggaggtaaaggaaaatcaggtgttggtaaagattatg
aatattggtgtttgtggatcagatattcatgtttatcatggaaaacatccgtttacaaaa
tatccggtaacacagggacatgaggtttccggtgagattacagaacttggaaaaaatgtc
acagagtttcatgtgggacagaaggtgacgatagagccgcaggtatattgtggacattgc
tatccatgtcgtcatggaaagtataatctctgtgaggaattaaaagtaatgggatttcag
acgacaggaacagcatctgagtattttgcagtggatgcatctaaagtaacaccgattcca
gaagatatgtcctatgaagaaggagctatgatcgaacctcttgctgtggcagtccatggt
gtaaaacagatgggcgatgtggctggcatgaatattgcagtccttggagcaggaccgatt
ggaaatctcgtggcacaggcagcaaaaggaatgggggcagcgaaagtgatgatcacagat
atcagtgatcttagactggcaaaggcaaaagaatgtggaattgatgtgtgtgtgaatacc
caaaataaagacttcggtgaggcaatgatcgaagcatttggaccggataaggcagatgtg
atctacgactgtgccggaaacaatatcacaatgggacaggcaattaaatatgcaagaaaa
ggaagcacgatcgtactggtggctgtttttgcaggaatggcagaagtagatcttgcagtg
gcaaatgaccacgaacttgacattaagagcacgatgatgtaccgccatgatgattacata
gatggaatcagactggtaaatgagggcaaagttcatttgaaaccgctcatctcaaagaca
tttgcttttaaagattatctgaaggcgtaccagtatattgatgataaccgcgagacaacg
atgaaagtaattatcaatgtcagtgaaaagtaa

DBGET integrated database retrieval system