KEGG   Ruminococcus sp. SR1/5: CK1_24660Help
Entry
CK1_24660         CDS       T02601                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
rum00473  D-Alanine metabolism
rum00550  Peptidoglycan biosynthesis
rum01100  Metabolic pathways
rum01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK1_24660
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CK1_24660
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CK1_24660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rum01011]
    CK1_24660
Enzymes [BR:rum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CK1_24660
Peptidoglycan biosynthesis and degradation proteins [BR:rum01011]
 Precursor biosynthesis
  Amino acid ligase
   CK1_24660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CBL20417
UniProt: D4LKQ6
LinkDB All DBs
Position
complement(2148782..2149897)
Genome map
AA seq 371 aa AA seqDB search
MNKRLKEILKQYEKRKHKIIKGDESMNIVVLAGGTSTEREISIVTGTGVCKALRKKGHNA
ILVDIFCGLEPVDWDEPFGDKDYEVDSAAEYMRSFDDDIEEIKRTRRSFFGPNVLELCQA
ADIVFMGLHGSNGEDGKVQATFDLLGIRYTGTGYLSSALAMDKGLTKKIFLMDQVPTPKG
VSMLKENCTRNIHDLGMEFPVVVKTCCGGSSVGVYIVNNQKEYEDAIDGAYSYEDEVVVE
EYIRGREFSVAVVDGKAYPIIEIAPKQGFYDYKNKYQAGSTVETCPAEISPELTEKMQHY
AEAGAKALCIEGYARFDFMMKENGDMYCLEANTLPGMTPTSLIPQEAKVLGIDYPDLCEE
LIRISFKKYSK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaataagagattaaaagaaatattaaaacaatacgaaaaaagaaaacacaagatcatc
aagggagatgaaagtatgaatatcgttgtattggcaggcggaaccagtacagaaagagag
atctccatcgtaacaggaaccggtgtctgcaaggcacttcgtaaaaaaggccataatgcc
attcttgtagatattttctgcggactggagccggtggactgggatgagccctttggagat
aaagattatgaggtagattctgcggcagagtatatgagaagcttcgatgatgatatcgaa
gagatcaaacgaacaagaagaagctttttcggaccgaatgtactggaattgtgtcaggca
gcagacattgtatttatgggacttcacggttccaacggagaggatggaaaggttcaggca
accttcgatcttctggggatccgttacacaggaaccggatatttaagcagtgcccttgct
atggataagggtctcaccaagaagatctttctcatggatcaggtaccgacaccgaagggc
gtctccatgctgaaagaaaactgtacaagaaacatccatgatcttggtatggaatttcct
gttgttgtaaaaacatgctgcggtggttccagcgtaggtgtttatattgtaaacaaccag
aaagaatatgaggatgccattgatggtgcttattcttatgaagatgaggtagttgttgaa
gagtatatcaggggccgtgagttttccgttgcagttgtagacggaaaggcttatccgatc
atcgagatcgcaccgaagcagggcttttatgattacaagaacaaatatcaggcaggctcc
acagtagaaacctgtccggctgagatctcaccggaactgaccgagaaaatgcagcattat
gcggaagctggcgcaaaggctctctgcattgagggctatgcacgttttgacttcatgatg
aaagaaaacggtgatatgtactgcctggaggcaaacacacttccgggaatgacacccacc
agtctgatccctcaggaagcaaaggtcctgggaattgactatccggacctctgtgaggaa
ctgatccgcatttcttttaagaaatacagcaaataa

DBGET integrated database retrieval system