KEGG   Runella sp. HYN0085: DR864_07135
Entry
DR864_07135       CDS       T05537                                 

Gene name
glpK
Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
run  Runella sp. HYN0085
Pathway
run00561  Glycerolipid metabolism
run01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:run00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    DR864_07135 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:run04147]
    DR864_07135 (glpK)
Enzymes [BR:run01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DR864_07135 (glpK)
Exosome [BR:run04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR864_07135 (glpK)
SSDB
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Other DBs
NCBI-ProteinID: AXE17519
UniProt: A0A344TFU8
LinkDB
Position
complement(1672514..1674013)
AA seq 499 aa
MSKYVAAIDQGTTSTRCIIFDRQGNIISVGQKEHQQIYPQPGWVEHNPEEIWKNTLEVIA
GARINASISATEIAAVGITNQRETTAVWNRKTGKPYYNALVWQDTRTGDLVNHFAQDGGQ
DRFRAQTGLPLATYFSGLKLKWLLDNVPGLREDAEKGEALFGTMDTFLIWNLTGGPHGGT
HVTDVTNASRTQLMNLHTLAWDSDMLAAFGIPSAMLPFIKSSSEVYGNVVLDVLPNVPIA
GDLGDQHAALVGQTCFEPGQAKNTYGTGCFMLLNTGTELKVSTQGLLTTVAYKFGNQPVN
YALEGSVAIAGALVQWLRDNLGMIEKSSDVETLAKSVEDNGGAYFVPAFSGLYAPYWKAD
ARGVIAGLTRYVTKAHIARAVLEATAYQTLDVMNAMEKDADIELKSLRVDGGMVANETLM
QFQADMLNVPVVCPAVTETTALGAAYAAGLAVGYWENFDDLRQNWGIAHTWNPKMESEQR
AKLYKGWHKAVERSFGWED
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtctaaatacgtagctgccattgatcagggtaccacgagtacccgttgcattattttt
gaccgacagggaaatattatttcagtaggtcagaaagaacaccaacaaatttatcctcag
ccaggttgggtggaacataaccccgaagaaatctggaaaaatacgctcgaagtgattgcg
ggtgcccgcatcaatgcgtcgatttctgctactgaaattgccgccgtcggcattactaac
caacgtgaaaccaccgccgtttggaatcggaaaactggaaaaccttattacaatgcccta
gtttggcaggatacccgtacgggcgacctagtaaatcattttgcccaagacggcggacaa
gaccgctttcgtgcccaaacaggcttgcctttggccacgtatttcagcggcttaaaactg
aaatggttgttggataatgtgcctggtctgcgcgaagatgccgaaaaaggagaggcgctt
tttggtaccatggataccttcctgatttggaatttgacgggagggccacacggcggcacg
cacgtaaccgacgtgaccaatgccagccgcacgcagttgatgaacctccatacgttggct
tgggattcagatatgttggctgcttttggcattccaagtgcgatgcttccttttatcaaa
agtagcagtgaagtgtatggaaacgtggtacttgatgtattgcccaatgtaccgattgcg
ggagacttgggcgaccaacacgcggcgttggttggtcaaacttgcttcgaacctgggcag
gccaaaaatacctacggaacgggttgttttatgttgctcaatacgggtacggagctaaag
gtctctacgcaaggactgcttacgacagtggcgtataaatttggaaatcaacccgttaat
tatgcgttggaagggagtgttgccattgcgggagcactggttcaatggctgcgtgataac
ttgggaatgattgaaaaaagcagtgatgtagaaacactggcaaaatcggtcgaagataac
ggcggggcgtattttgtgccagcattttcgggtttgtatgcgccttattggaaggctgac
gctcggggagtaattgcgggcttgacgcgctacgtgaccaaggctcacattgcacgggcg
gtgctggaagcaacggcttatcaaaccctcgacgtaatgaacgcgatggaaaaagacgct
gatattgagcttaaatcattgcgcgtggacggtggcatggtcgccaatgaaacgctcatg
cagtttcaggcggatatgctcaacgtacccgtcgtttgcccagcggtgaccgaaactacg
gctttgggcgcggcgtatgcggcaggtttggcggtaggctattgggaaaacttcgacgat
ttacgtcagaattgggggattgcccatacctggaaccctaaaatggaaagtgagcaacgg
gctaaattatacaaaggttggcacaaagccgtagagcgctcttttggctgggaagattga

DBGET integrated database retrieval system