KEGG   Runella sp. HYN0085: DR864_09870Help
Entry
DR864_09870       CDS       T05537                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
run  Runella sp. HYN0085
Pathway
run00473  D-Alanine metabolism
run00550  Peptidoglycan biosynthesis
run01100  Metabolic pathways
run01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:run00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DR864_09870
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DR864_09870
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DR864_09870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:run01011]
    DR864_09870
Enzymes [BR:run01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DR864_09870
Peptidoglycan biosynthesis and degradation proteins [BR:run01011]
 Precursor biosynthesis
  Amino acid ligase
   DR864_09870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A HU-CCDC81_bac_1 Spore_YtfJ
Motif
Other DBs
NCBI-ProteinID: AXE18020
UniProt: A0A344TH99
LinkDB All DBs
Position
2306955..2308628
Genome map
AA seq 557 aa AA seqDB search
MRIGIFFGGPAREREISYAGGKTAYENIDKALFTPVLVFVDSLGNFILTDESTLYHASIR
AFYPGPAFREGGFEVYIESLQQQLSQAELEALMHGIGTPIQPQDFKKYFDFAFIILHGPD
CEDGAIQGLMEWHKMPYMGPGLLGSAVSIDKILQNEQIARANGQQKKMKVVRWEEWHGGD
VNAIFEAAKAAVGLPIVVKAPHQGSSIGVAIVKEDSATAFAAAMNQCFFSLEIKSDDWKS
WSEAEKHAFAQRIGNLDESIGYPVVIQETGETIYHPIDLIEKLDSSLFSSHVSLLSVNAE
DQVLLEEFMTGQEFSCGVIQDNDGTVIALPPTEIAKMDENQTFDFKTKYKLNVTRKFIPV
RTVLENNQKIQYNIALVFEKLGMNAVARIDGFLTPDGRVLLHDPNTLPGMSPTSLIFKQM
AEIGLDVTHAITYLIRQSLRERIRTGKDTVHLRQLLAALDVKIEQKLAELTFQSVEFEAT
TEAYIEARRTFSQLSASGKVKPTAVLKISDEEKYELPVSLLFKDTIEDVLEMISQPLHPL
IEETREKAKNITRRFVG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcggaatcttttttggcggacccgcgcgtgagcgcgaaatatcttatgcaggc
ggtaaaacggcctacgaaaacattgataaggcgttgtttacgcccgtattggtgttcgtg
gatagcctcggcaattttatcttgaccgatgaatcaaccctttatcatgccagcatccgc
gctttttatccgggccctgcattcagggaaggtggttttgaagtatacattgagtcatta
cagcaacaactttcgcaggctgaattggaagccctaatgcacggtattggcacgccgatt
caaccgcaggatttcaaaaaatatttcgattttgctttcatcatcctccacggtcccgat
tgtgaagatggtgcaattcagggcctaatggagtggcacaaaatgccatatatgggccca
ggattacttggatcggcggtaagtattgataaaatcttgcaaaatgagcaaatcgcccgc
gccaacggtcaacagaaaaaaatgaaagtagttcgctgggaggagtggcacgggggcgat
gtaaacgccatttttgaggctgccaaagccgccgtaggattgcctattgtggtaaaagca
ccccaccaaggctcctcgattggggtagcgattgtaaaagaagacagcgctacggccttt
gctgccgctatgaatcaatgttttttctcattagaaataaagtccgacgattggaaaagt
tggtcagaagccgaaaaacacgcttttgcgcagcgcatcggcaaccttgatgagagcatc
ggttatccggtagtgattcaagaaaccggcgaaaccatttaccacccaatcgacttaatt
gaaaaactggattcatctctcttttcttctcacgtctcgctgctctccgtgaatgccgaa
gaccaagtgttattggaagaatttatgacgggacaggagttttcgtgcggcgtaattcag
gacaacgacggcaccgtcattgccttgcctcctaccgaaattgccaaaatggacgaaaac
cagacgtttgatttcaagaccaaatacaaactcaacgtcacccgtaagtttattcccgtc
agaacggtactggaaaacaaccaaaagattcagtacaacattgcattggtatttgaaaaa
ttgggcatgaacgccgtagctcgcattgacggcttcctcactcccgacggacgtgtactg
ctccacgaccccaatacgctgcctggaatgtcgcctacctcgttgattttcaaacaaatg
gccgaaatcggattggatgttacgcacgccatcacgtatctgattcgccagtcattgcgc
gagcgtattcgcacgggcaaagacactgtacatttacggcaattgctggcggctttagat
gtcaaaattgaacaaaagcttgccgagcttacttttcaatcggttgaatttgaggctact
acggaggcttacatcgaagctcgccgtactttcagccaactttctgcttcgggtaaagta
aagcccactgcagtattgaaaatcagcgatgaagaaaaatacgaattaccagtaagtctg
ctttttaaagatacaattgaagatgtattggaaatgatttcacaacccctgcacccgctc
atcgaagaaacccgcgaaaaagcgaaaaatattacccgtcgttttgtgggataa

DBGET integrated database retrieval system