KEGG   Runella sp. HYN0085: DR864_17655Help
Entry
DR864_17655       CDS       T05537                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
run  Runella sp. HYN0085
Brite
KEGG Orthology (KO) [BR:run00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:run01001]
    DR864_17655
Enzymes [BR:run01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DR864_17655
Protein kinases [BR:run01001]
 Serine/threonine kinases: Other
  Bacterial family
   DR864_17655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AXE19438
UniProt: A0A344TLB7
LinkDB All DBs
Position
complement(4199507..4200391)
Genome map
AA seq 294 aa AA seqDB search
MQLGQNIKGYVLTQWLGSGGMGEVYQAQHQTSRRPAAVKVLYRADQAARFRNEAYIQASV
QHPHIAALYEYTIENGTPCIIMEYVEGITLEKLIKRQGRLPEAFVWKVMEQIVLAVIYLH
ERHIIHRDLKPGNVKVNRESFAKLLDFGIAKSTYTPKLTQEGYIVGTSHYMAPEQFHGKV
SIQSDCWSLGVLFYEMLTGHLPFDGRSETEVRLKIERGQYTSPDLLVPHLTKRSKRLIHK
LLRINSANRMTAAELLQELTSPADNGFSLAEWVDTFTDFMGKISVKRWIRTKNH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaggccaaaacataaaaggctacgttttaacgcaatggctaggctcgggagga
atgggcgaagtgtatcaggcacaacaccaaacctctcgccgcccagcggcggtgaaagtc
ctctaccgagccgaccaagccgcccgctttcgtaacgaggcttacattcaggcttctgtg
caacatcctcacattgcggccctttacgaatacacgattgaaaacggtacgccctgcatt
atcatggaatatgtcgaaggaattacgctcgaaaaactcatcaaacgtcaaggccgactg
cccgaagcgtttgtctggaaggtaatggaacagattgtgttggcggtgatttatttgcac
gaacgacacatcatccaccgggatttgaaaccgggaaacgtaaaagtaaatcgtgagagt
tttgccaaattgttggattttggaatcgccaaatcgacttatacgcccaaactcacgcag
gaaggatacatcgtcggaacgtcgcattacatggctcctgagcagtttcacggcaaagta
agcattcagtctgattgttggtcgttaggggttttattctacgaaatgctgacggggcat
ttgcctttcgacggtcgcagcgaaacggaagttcgcttaaaaattgaacggggacagtac
acttcccccgatttattggttccacatttgacaaaaagaagcaagcgtctcattcataag
ttgttgcgaatcaatagcgccaatcgaatgacggcggcggaactgctgcaagaattaaca
agcccagcagacaacggattttcgcttgcagaatgggtggataccttcacggattttatg
ggaaaaatctccgtaaaacgttggataagaacaaaaaatcattga

DBGET integrated database retrieval system