KEGG   Runella sp. HYN0085: DR864_21685Help
Entry
DR864_21685       CDS       T05537                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
run  Runella sp. HYN0085
Pathway
run00290  Valine, leucine and isoleucine biosynthesis
run00770  Pantothenate and CoA biosynthesis
run01100  Metabolic pathways
run01110  Biosynthesis of secondary metabolites
run01130  Biosynthesis of antibiotics
run01210  2-Oxocarboxylic acid metabolism
run01230  Biosynthesis of amino acids
Module
run_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
run_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:run00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    DR864_21685 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DR864_21685 (ilvD)
Enzymes [BR:run01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     DR864_21685 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AXE20175
UniProt: A0A344TNF4
LinkDB All DBs
Position
5231389..5233074
Genome map
AA seq 561 aa AA seqDB search
MSEQLNKFSRTLTQEVTNPAAKAMLYGVGLTKEDMQKAQIGIASTGYEGNTCNMHLNGLS
VHVKKGIQENGMVGLIFHTIGVSDGMTNGNDGMSYSLPSRDLIADSIENVVGAQWYDGVI
AVVGCDKNMPGAMMAIARLNRPAMLVYGGTIRTGEYKGQKLDIISAFEALGKKFAGTISE
EDYEGVIQNAIPGAGACGGMYTANTMASSMEAMGLTLPNSSTYPATHEGKKAECIAIGAA
MKQLLEKNICPRDIMTRKAFENAMTVVMALGGSTNAVLHYLAIARAAEVDFTLKDIQDIS
DRTPLIADLKPSGKYYMEDVLAIGGVPAIMKYLYQQGLLHGDCLTVTGKTIAENLAEAPD
LNFDTQKIIFPLSTPLKPTGHLQIMYGNLATEGAVAKITGKEGERFEGTAKVCEREEEVI
EYISKGEIKAGHVIVIRNEGPKGGPGMPEMLKPTSAVMGAGLGDKIAMITDGRFSGGTHG
FVVGHITPEAYMGGTIGLVKDGDKITIDAVNNVLQLHVSDEELAERRKEWKQPEPPFKKG
TLGKYIRNVKSASEGCVTDEA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaacttaacaaattcagccgcactcttacgcaagaagtaacaaatcccgcc
gccaaagccatgctctatggcgtaggattgaccaaagaagacatgcaaaaagcccaaatt
ggcattgccagtacgggttatgaaggaaacacctgcaacatgcacctcaacggattgtcg
gtgcatgtaaaaaaaggaattcaggaaaatggcatggtcggccttatttttcacaccatt
ggtgtatccgatggcatgactaacggcaacgacgggatgagctactcgctgccaagccgt
gacttgattgccgattctatcgaaaacgtagtgggtgcccaatggtacgacggagtgatt
gcggtggtaggttgtgacaaaaatatgccaggagccatgatggccattgcccggttgaac
cgcccagccatgttggtctacggcggaacgatccggacgggagaatataaaggacagaaa
ctcgacattatttcggcgtttgaagccttgggcaagaagtttgccggaacgatttcggaa
gaagactacgaaggagttattcaaaatgccattcctggtgcaggagcttgcggcggaatg
tacacggccaataccatggctagctcaatggaagcaatgggcttaacgctgcccaattca
tcgacctatccggccacgcacgaaggcaaaaaagcggagtgtatcgccattggagcggcc
atgaaacaattgctggagaaaaacatttgcccgcgcgacatcatgacgcgcaaagccttt
gaaaacgccatgacggtggtgatggcgctgggcggttcgaccaacgccgtgttgcattat
ctggccattgcccgtgccgcagaagtagattttacgctaaaagatattcaggatatttcg
gaccgtacgccattgattgccgaccttaaaccgtctggtaagtattatatggaagatgta
ttggccattggcggagttccagccattatgaaatatttatatcagcagggtcttttgcac
ggcgattgcttgaccgtaacgggtaaaaccattgctgagaatttggccgaagcacctgat
ttgaatttcgatacccaaaaaatcattttcccgctttcgacacccctcaaacccacggga
cacttacaaatcatgtacggaaacttggcaacggaaggtgccgtggctaagattactggc
aaagaaggtgagcgttttgaaggaacggccaaggtatgtgagcgcgaagaagaagtcata
gaatacatttcaaaaggtgaaatcaaagcggggcatgtcatcgtgattcgcaatgaaggc
cccaaaggcggtccgggtatgcccgaaatgcttaaacctacctcggcggtgatgggagcg
ggtctgggtgacaaaatcgcgatgattaccgatggtcgtttttcgggtggtacgcatggt
tttgtggtgggccacatcacgccagaagcctacatgggcggaaccattggcctggtaaaa
gacggcgataaaattacgattgatgccgtaaacaacgtattgcaactgcacgtctcggac
gaagaactggccgagcgtcgtaaggagtggaaacaacccgagccgccgtttaaaaaaggg
acgttaggcaaatacatccgcaatgtgaagtcggcaagcgaaggctgtgtaacggatgaa
gcgtaa

DBGET integrated database retrieval system