KEGG   Runella sp. SP2: DTQ70_00370Help
Entry
DTQ70_00370       CDS       T05690                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rup  Runella sp. SP2
Pathway
rup00473  D-Alanine metabolism
rup00550  Peptidoglycan biosynthesis
rup01100  Metabolic pathways
rup01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DTQ70_00370
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DTQ70_00370
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DTQ70_00370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rup01011]
    DTQ70_00370
Enzymes [BR:rup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DTQ70_00370
Peptidoglycan biosynthesis and degradation proteins [BR:rup01011]
 Precursor biosynthesis
  Amino acid ligase
   DTQ70_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AYQ30725
UniProt: A0A3G3GH74
LinkDB All DBs
Position
85076..86767
Genome map
AA seq 563 aa AA seqDB search
MRIGIFFGGPAREREISYAGGKTAYENIDKTLFTPVLVFVDSLGNFILTDEEKLYHSGIR
EFYPGPAFRDGGFEVYIESLQQQLAPQEIEALMHAIGTPIQPKNFKTYFDFAFIILHGPD
CEDGAVQGLLEWHKIPYMGPGLLGSAVSIDKILQNEQIARANGQQKKMQVVRWEQWRGTE
AAEVFEAAKAELGLPIVVKAPHQGSSIGVSIVKEDSLDDFVKAMNQCFFALEVTADEWKG
YSKEEKHTFAQRIANLDESIGYPVVIEQTGEFIYHPTELIEKLGNWSTGNSQPEILKLTL
LSANAEDQVLLEEFVKGQEFSCGVIQDNDGTVIALPPTEIAKLEENQTFDFKTKYKLNVT
RKFIPVRTSLENNQKIQYNIALVFEKMGMNSVARIDGFLTPDGRVLLHDPNTLPGMSPTS
LIFKQMAEIGLDVTHAITYLIRQSLRERIRTGKDTVHLRQLLAALDEKIAAQLAEITTEE
VVFEATQEGYLEGRRRFSQLSASGKVKPIAVLQTSESEKVVMPVNLLFKDTIDDVLEALA
QPIHPLIEETRAKAINVTKRFVG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggaatcttttttggcggcccagcgcgtgagcgcgaaatctcttatgcgggt
ggtaaaactgcctatgaaaacatcgacaagacgttgttcactcctgtattggtgtttgtg
gacagcctcggtaattttatcctgaccgatgaggaaaaattgtaccattcggggattcgg
gaattttatcctgggcctgcgtttcgtgatggtgggtttgaagtgtatatcgagtcgttg
cagcagcagttggctccgcaagaaattgaggcattaatgcacgctatcggaacgccgatt
cagccgaaaaactttaaaacgtatttcgattttgcgtttatcatccttcatggccccgac
tgcgaagacggagccgtccaaggtttgttggagtggcataaaatcccgtacatggggcca
ggcttattggggtcggcggtgagtattgataaaattttgcaaaacgagcaaattgcccgc
gccaatggacagcagaaaaaaatgcaggtggttcgctgggaacaatggcgcggaacggaa
gccgccgaggtatttgaagcggccaaggcggagttgggtcttcctattgtcgtaaaagcc
ccgcaccaaggctcgtcgattggggtttcaattgtcaaagaagatagcctcgacgacttt
gtgaaggccatgaaccagtgcttttttgctttggaagtaactgccgacgaatggaaaggc
tactcgaaggaggaaaaacacacatttgcgcagcgcattgccaatctcgacgaaagcatt
ggctaccccgtcgtgatagaacaaacgggcgaatttatctatcaccccaccgaattgatt
gagaaattgggaaattggtcaacgggaaacagtcaacccgaaattcttaaactgactctc
ttatccgccaatgccgaagaccaagttttattagaagagtttgtgaaagggcaggagttc
tcgtgcggggtgattcaggataacgacggtacagtgattgcgttgccgcctaccgaaatt
gctaaattggaagaaaatcaaacctttgactttaagacaaaatacaaattaaacgttact
cggaaatttattcctgtacgtacgtcgctcgaaaacaaccaaaagattcagtacaacatt
gcgttggtatttgaaaaaatgggcatgaattcggtcgcacggattgacggatttttaaca
cccgacggccgcgttttgctccacgaccccaacaccctgcctgggatgtcaccgacgtca
ttgatttttaaacaaatggctgaaattggcttggacgttacgcacgccatcacgtacctg
attcgtcagtcgttgcgcgaacgcattcgtacgggaaaagacacggtacatctgcgtcaa
ttattggcggcattggacgaaaaaattgccgctcaattggccgaaattacgactgaagaa
gtggtatttgaagcgactcaagaaggctatttggaaggtcgccgtcgttttagtcagtta
tcggcgtcgggaaaagtaaaacctattgctgtgttgcaaaccagcgaatcagaaaaagtc
gtgatgcctgtcaatttgttattcaaagataccatcgacgacgttttagaggcgttggcg
cagcccattcatccgctgattgaagaaacccgcgccaaagccatcaacgttacgaagcgt
tttgtggggtaa

DBGET integrated database retrieval system