KEGG   Runella sp. SP2: DTQ70_00505Help
Entry
DTQ70_00505       CDS       T05690                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rup  Runella sp. SP2
Pathway
rup00010  Glycolysis / Gluconeogenesis
rup00020  Citrate cycle (TCA cycle)
rup00620  Pyruvate metabolism
rup01100  Metabolic pathways
rup01110  Biosynthesis of secondary metabolites
rup01120  Microbial metabolism in diverse environments
rup01130  Biosynthesis of antibiotics
rup01200  Carbon metabolism
Module
rup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DTQ70_00505
   00020 Citrate cycle (TCA cycle)
    DTQ70_00505
   00620 Pyruvate metabolism
    DTQ70_00505
Enzymes [BR:rup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DTQ70_00505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: AYQ30750
UniProt: A0A3G3GHM6
LinkDB All DBs
Position
122443..124080
Genome map
AA seq 545 aa AA seqDB search
MAEVIRMPKMSDTMTEGVIAAWHKKVGDVIKSGDIIAEVETDKATMDMESYQEGTLLYIG
VEKGSAVPVDGILAIIGAPGEDYQALLGGGAAPAPAEAPAAPAPQEVAAPAPAAAPAAPA
APAAPVNATVVRMPKMSDTMTEGVLVAWLKKVGDVVKSGDIIAEVETDKATMELENYEDG
TLLYLGVKEGEAVPVDGIIAIVGEAGADYQSLLSPQAASAPAPAAPAAVASAPAATAAPA
AATSGDGRIKASPLAKALAKDKGVDLSQVVGTGEGGRIVKKDIDGASAVSSQQPAVSTQA
PAPKAQSAAPAAPAAPAVGDFEDTPVSQMRKTIARRLSESLFTAPHFYLTMEITMDKAME
LRGKINEVSPVKVSFNDMVIKAAALALKQHPAINSAWLGDKIRKYNYVNVGVAVAVDEGL
LVPVVRDADKKTLSVIASEVKDMAGKAKDKKLQPKDWEGNTFSISNLGMFGIDEFTAIIN
PPDSCIMAVGGIKKVAAFKEDGSIYPTNIMKVTLSCDHRVVDGATGSAFLQTFKKLLENP
LGMLV
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatccgaatgcccaaaatgtctgatacaatgaccgaaggggtcattgca
gcttggcacaaaaaagtaggagatgtaatcaaatcaggtgatattatcgccgaagtagaa
actgacaaagcgaccatggacatggagtcgtaccaagaaggtacacttctttacattggc
gtagaaaaagggtcggcggtgcccgttgatggtattcttgccattatcggagctccaggc
gaagactatcaagcattgttgggtggaggagctgctcctgcccccgctgaagcaccagcc
gcgcctgctccacaggaagtagctgcgccagcacctgctgctgctcctgcggcgccagct
gcaccagccgctccagtaaacgcaacggtggtacggatgcctaaaatgtcggatacgatg
accgaaggtgtgctcgttgcatggttgaaaaaagtaggagatgtagtgaagtcgggtgac
attattgctgaagtcgaaaccgacaaagcaacgatggaactcgaaaactatgaagacgga
acgcttctttatctaggagtaaaagaaggtgaagccgtacctgtcgatggaattattgct
attgttggtgaggcaggagctgattatcaatctcttttaagcccccaagcagctagtgca
cctgcgccagccgcaccagcggcagtggcttctgctccagcggcgaccgctgctccagca
gctgcaacaagcggagatggacgtatcaaagcttctccgttggcaaaagcacttgccaaa
gataaaggtgttgatttaagccaagttgttggaactggcgaaggcggtcgtattgtgaaa
aaggacattgatggcgcttctgcggttagcagccagcagccagcagttagcactcaggcg
cctgctccgaaagcacaatcagctgcaccagcagctccagcagcccctgcggttggagac
tttgaagatactcctgtatcgcaaatgcgtaagacgattgcccgtcgtttgagcgagagc
ctatttactgctccgcatttctaccttaccatggaaattaccatggacaaagcgatggaa
ttgcgcggtaaaatcaacgaagttagcccagtgaaagtgtcgttcaacgacatggttatc
aaggcggcagcgttggcacttaaacaacatcctgccattaactcggcatggttgggcgat
aaaatccgcaagtacaactacgttaacgttggggtagcagtagcggttgatgaaggtttg
ttggtacctgtggttcgtgatgctgacaagaaaaccctttctgtcattgcaagcgaagtg
aaagacatggcaggaaaagcaaaagataaaaaactacaacctaaagactgggaaggcaat
acattctcgatttcaaacttaggtatgtttggtatcgacgaatttacggccatcatcaac
ccgccagattcgtgtatcatggccgtaggaggtattaagaaagtagctgctttcaaagaa
gatggtagcatttatcctaccaacatcatgaaagtaacgctttcgtgtgaccaccgtgtg
gtggacggtgctacaggttctgctttcttacaaacatttaagaaattgttggaaaaccca
ctcggaatgttggtttag

DBGET integrated database retrieval system