KEGG   Runella sp. SP2: DTQ70_22480Help
Entry
DTQ70_22480       CDS       T05690                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rup  Runella sp. SP2
Brite
KEGG Orthology (KO) [BR:rup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rup01001]
    DTQ70_22480
Enzymes [BR:rup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DTQ70_22480
Protein kinases [BR:rup01001]
 Serine/threonine kinases: Other
  Bacterial family
   DTQ70_22480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal APH RIO1 WaaY
Motif
Other DBs
NCBI-ProteinID: AYQ34766
UniProt: A0A3G3GTP0
LinkDB All DBs
Position
complement(5563222..5564112)
Genome map
AA seq 296 aa AA seqDB search
MQEPLIHRTIRGYQLTQWLGAGGMGEVYMAQHQTTRRTAAVKVLYRADQAARFRNEAYIQ
ASVQHPHIAALYEYVIEDSTPCIIMEYVEGITLEKLIKRQGRLPESFVWKVLAQVATAVA
HLHQKGIIHRDLKPGNVKVNKDSFAKLLDFGIAKSAYTPKLTQEGYIVGTAHYMAPEQFQ
GKVSMQSDCWALGVLLYEMLTGYLPFNGRTETEIRVKIEKGDYTEPDLLAPQISKRSKRL
IGKLLRVNPTSRISAAALIQELESPQSDHGFGLTDWVDNLTEFVEKLPVKRWFKNR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagccattaatacatcgaacaattcgaggctaccaacttacgcagtggttggga
gcaggagggatgggggaggtttacatggcccagcatcagactactcgccgaacggccgcc
gtcaaggtgctgtaccgtgccgaccaagcggctcgttttcggaacgaagcctacatccaa
gcctcggtacagcacccccacattgccgctctgtacgaatacgttatcgaagacagcacc
ccttgcatcattatggaatacgtggagggaatcacgctcgaaaagctcatcaagcgccaa
ggacgccttcctgagtcgtttgtgtggaaagtgttggcgcaggtggctaccgcagtggct
catttacaccaaaaaggaattattcaccgcgatttgaagccaggcaatgtgaaggtcaac
aaagatagttttgccaaacttcttgattttggaatcgctaaatcggcctatacacctaag
ttgacgcaagaaggctacatcgtcggaacggcgcattacatggctcctgagcagtttcaa
ggaaaggtaagtatgcagtccgattgctgggcgttgggggttttgttgtacgaaatgctg
acaggttatttgcccttcaacggacgtactgaaaccgagattcgggttaagattgaaaaa
ggagattataccgagcccgatttgttggcaccacaaatttcgaaacggagcaaacgcttg
attggtaaactgttgcgtgtcaatccgaccagtcgcatcagcgcggcggccttgattcaa
gagttagaaagcccgcagtcggaccatggatttgggcttaccgactgggtggataacttg
accgaatttgttgaaaaactacccgtaaagcgttggtttaaaaatagataa

DBGET integrated database retrieval system