KEGG   Runella sp. SP2: DTQ70_22560Help
Entry
DTQ70_22560       CDS       T05690                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rup  Runella sp. SP2
Pathway
rup00620  Pyruvate metabolism
rup00680  Methane metabolism
rup01100  Metabolic pathways
rup01120  Microbial metabolism in diverse environments
rup01200  Carbon metabolism
Module
rup_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DTQ70_22560
  09102 Energy metabolism
   00680 Methane metabolism
    DTQ70_22560
Enzymes [BR:rup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DTQ70_22560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Gag_p15
Motif
Other DBs
NCBI-ProteinID: AYQ34781
UniProt: A0A3G3GU68
LinkDB All DBs
Position
complement(5584053..5586626)
Genome map
AA seq 857 aa AA seqDB search
MPNVYQDAVVTKYNIFNSLFLSLPFQDIYRTGTLLPLLVQASEEGFNAGKSPLQIIESFF
EEYTENATEDERRDLLFNLIKFIERQVVLFDSVEDAGFDHTHDSNGQGSLTQLLNRVDSD
DLRQKLLRKLEDFCVRIVLTAHPTQFYPGKVLGIITDLEESIKDNDFVEVNHLLLQLGKT
GFINKNKPTPLDEAMTLCWFLENVFYKAIPMLVQRLLNGLEVPMNEWKHTGLFRLGFWPG
GDRDGNPFVTSDVTLEVADRLRQILLKCYWRDIKYLKRRLTFNGVEEFISTAERKTNNAI
YYPDQEHYTKAEELLADLSQAREVLVRDHDSLFVELLDETVLKIKLFGFFFASLDIRQVS
PKHSLAWQEILTKIEKQVPVFSFSDYESWDEKRKIDFLLSLQVELAESDFKDPITQDIYG
SMLAIREIQKRNGIEGAHRYVISNCASALNVVEVLALFKNVWKTDDLHVDIVPLFETVDD
LANASEVMKMLYENPYYRAHLAKRGNQQTIMVGFSDGTKDGGYLRANWSIFSAKEQLTKI
SREYDVKVTFFDGRGGPPGRGGGNNHAFYASLGKDIEDKEIQLTVQGQTISSNYGTVPTA
IYNLERLFTAGLENNLFMSKNTKDQLSEADKALMEELADAAYHAYLGLKNHPTFVPYLEK
ITPLRFYGQTKIGSRPDKRGSGGGLKFEDLRAIPFVGSWAQMKQNVPGFYGFGSGLETLK
NEGKMDALKKLYKRSLFVRTLVENSMQSLMKAYYPATKYLQDNPEFATIWNMMFEEYERS
IRLMLEFSGEKDLLNQNPVTKESIKIRERIVLPLMTIQQYALQKLQSGELSSADVDVFNK
LVIRAMFGIINAARNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacgtttatcaagacgctgttgtaacgaaatataacattttcaacagcctgttt
ctgagcttaccgtttcaggacatctaccgtacgggtacgcttcttccgttgcttgttcag
gcgagtgaggaagggtttaatgcgggcaaaagccctttgcaaatcatcgagtcgtttttt
gaggaatataccgaaaatgcgaccgaagatgaacgtcgcgacttgctatttaacttaatc
aagttcattgaacggcaagttgtattgtttgattccgtggaagatgcgggttttgaccac
acacatgacagcaatgggcaagggtcgcttacgcagcttctcaatcgggtcgatagcgac
gatttgcgccaaaagcttcttcgtaagttagaagacttttgtgtacgcatcgtgttgaca
gcccaccctacgcaattttacccaggcaaagtacttggtatcatcactgatttggaagaa
tccatcaaagacaatgactttgtggaagtaaaccatcttctattgcagttgggaaaaacg
ggctttatcaacaaaaacaagcctacgccgctggatgaagccatgacgttgtgttggttt
ttggagaatgtattttataaagccatcccgatgcttgtgcaacgcctgctcaatggcctt
gaagtaccgatgaacgaatggaaacacacgggtttgttccgcttgggcttttggcctgga
ggcgaccgcgacggaaacccgtttgtcacttcggacgtgacattggaggtggctgaccgt
ttgcgccagatattgctcaagtgttattggcgtgatattaaatacctcaaacgccgattg
acctttaatggggtagaagagtttatctcaacggcagagcgtaagaccaacaacgcgatt
tattatcctgatcaagagcactacaccaaagccgaagaactattggcggacttgagccaa
gcacgggaagtattggtacgcgaccacgattcactctttgtggagttgttggatgaaaca
gtgttgaaaatcaagctatttggtttcttttttgctagtttggatattcgtcaagtaagt
cctaaacactcattggcgtggcaggaaattcttacgaaaattgaaaaacaagttcctgtt
ttctcattctctgattatgaaagttgggatgaaaaacgaaaaatagatttcttgttgtcg
ttgcaggtagagttggcagaaagcgatttcaaagacccgattacgcaagatatttatggt
tcgatgttggccattcgtgaaattcagaaacgaaatggaatagaaggagctcaccgctat
gtcatcagcaactgtgcgagtgcgcttaacgtggtggaagtattggcgttgtttaaaaat
gtttggaaaacagatgatttgcacgttgatattgtcccgctttttgaaactgtagatgac
cttgcaaatgcgtcggaggtaatgaaaatgttgtacgaaaatccgtattatcgggcgcat
ttagccaagagaggcaaccaacaaaccatcatggtgggtttctccgacgggaccaaagac
ggaggatatttgcgggcaaactggtcaattttctcagccaaagagcaactcacaaaaatt
tcgcgcgagtacgatgtaaaagtgaccttcttcgacggtcgtggagggcctccaggtcgt
gggggaggaaacaaccacgcgttttatgcgtcgttggggaaagatattgaagacaaagaa
attcagttgacggttcagggacagaccattagctccaactatggtacagtgccaacggcc
atttataacttagaaagattgtttacggcagggttggaaaacaatctttttatgtccaaa
aacaccaaggatcaactttctgaggccgataaggcgctgatggaagagttggccgatgcg
gcgtatcatgcgtatttgggactcaaaaatcacccgacgtttgtgccgtatttggagaaa
attacgcctttacgtttttacggacaaaccaaaattggtagccgacccgacaagcgtgga
agcggtggtggactcaagtttgaagacctccgcgcgattccgtttgtgggttcttgggcc
cagatgaaacaaaatgtacctggtttttacgggtttgggtcaggtttggaaacgttgaaa
aacgaagggaaaatggatgctttgaagaagctctataagcgttcgttgtttgttcgtacg
ttggtcgaaaactcaatgcagtcgctgatgaaggcgtattatccagctaccaaatacctc
caagacaatccagagtttgcaacgatttggaacatgatgtttgaggaatacgagcgtagt
attcgattgatgttggagttttcgggcgaaaaagacttattaaaccaaaacccagtcacc
aaagagtccatcaagattcgggagcgaattgtcttgccgttgatgacgattcaacagtac
gcgcttcaaaaactacaaagtggagagctctcttccgctgacgtagatgtgttcaataag
cttgtcattcgggcgatgtttggtatcatcaacgccgcgcgcaactctgcctaa

DBGET integrated database retrieval system