KEGG   Runella sp. SP2: DTQ70_27360Help
Entry
DTQ70_27360       CDS       T05690                                 

Definition
(GenBank) M20/M25/M40 family metallo-hydrolase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
rup  Runella sp. SP2
Pathway
rup00220  Arginine biosynthesis
rup01100  Metabolic pathways
rup01110  Biosynthesis of secondary metabolites
rup01130  Biosynthesis of antibiotics
rup01210  2-Oxocarboxylic acid metabolism
rup01230  Biosynthesis of amino acids
Module
rup_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    DTQ70_27360
Enzymes [BR:rup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     DTQ70_27360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AYQ35659
UniProt: A0A3G3GWY4
LinkDB All DBs
Position
complement(6798941..6800026)
Genome map
AA seq 361 aa AA seqDB search
MSETNMTLSPNALAQEAIALLKQLISTQSFSREEEGTAALIEAFFQRKGIPFHRKKNNIW
AYNRYFDASKPTVLLNSHHDTVKPNPSWTLNPYEPLEKDGKLFGLGSNDAGGSLCSLIVT
FCHFYDNPHLTYNVVMAATAEEEISGREGLELIVPDLPPIEFAIVGEPTEMHLAVAEKGL
LVLDCIAHGKSGHAAREEGENAIYKAIDDIQWIRSYQYPKVSPTLGPIKMSVTIVNAGTQ
HNVVPDSCKFTIDVRVTDQYTLEEIIDIINKNIKSEIAARSIRLRPSSIPMEHPIVQAGV
RLGRNTYGSPTTSDQALIDCPSLKMGPGHSGRSHTADEFIYLHEIEEGVAQYIKMLEDVI
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaaacatgacactatcgcctaacgcgcttgcgcaagaggccatcgcatta
cttaaacaactgatttctactcagtcgtttagtcgagaagaagaaggaactgccgctttg
attgaagcatttttccaacgcaaagggattccattccaccgcaaaaaaaacaacatttgg
gcttacaatcgctacttcgacgccagcaagcccacggttttactcaactctcaccacgat
accgtcaaaccgaatccgtcttggacgctcaacccgtacgaacctctcgaaaaagacggg
aagctcttcgggctaggtagcaacgacgcgggtgggtcgctgtgttcgctcatcgtgacg
ttttgtcatttttatgataaccctcatttgacctacaatgttgtgatggctgccaccgcc
gaagaagaaatttcgggacgtgagggccttgaactgattgtacctgaccttcctcccatc
gaatttgcgatcgtaggcgaacctaccgaaatgcacttagccgtggccgaaaaagggcta
ttggtcttggattgcattgcgcacggaaaatcgggccacgcggcacgggaagaaggtgaa
aacgctatctacaaagccattgacgacattcagtggattcgttcgtaccagtatccaaaa
gtctctcctacgctcggccccatcaaaatgtcggtgacgattgtcaacgcaggtacgcag
cacaacgtagttcctgattcctgcaaatttaccattgatgtccgcgtgactgaccaatat
actttggaagaaatcattgacatcatcaataaaaacatcaaatcagaaattgccgcccgt
tcgatacgtttgcgcccgtcgagcattccgatggagcatcctatcgtacaagcaggtgtt
cgtttgggaagaaacacctacggttctcccaccacctccgaccaagccctcatcgactgc
ccttcgctcaaaatggggccagggcattcggggcgttcgcatacggcggatgaatttatt
tacctccacgaaatcgaagaaggagtcgctcagtacatcaagatgttggaagacgtgatt
ttatag

DBGET integrated database retrieval system