KEGG   Ruminococcus bicirculans: RBI_I01011Help
Entry
RBI_I01011        CDS       T03158                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rus  Ruminococcus bicirculans
Brite
KEGG Orthology (KO) [BR:rus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rus01001]
    RBI_I01011 (prkC)
Enzymes [BR:rus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RBI_I01011 (prkC)
Protein kinases [BR:rus01001]
 Serine/threonine kinases: Other
  Bacterial family
   RBI_I01011 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Shisa PBP1_TM CENP-B_dimeris DUF3439 Mucin Pkinase_fungal Kdo Seadorna_VP7 ABC1 LRRC37AB_C DUF3915 FTA2 Orf78 NOA36 DUF1325 SSP160
Motif
Other DBs
NCBI-ProteinID: CCO04726
UniProt: W0U5J2
LinkDB All DBs
Position
I:1134763..1136883
Genome map
AA seq 706 aa AA seqDB search
MDSNIGKKLDGRYEITELIGVGGMADVYKAVDVMENRTVAVKILKPEFSQNEEFLRRFRN
ESKAIAVLSHPNIVKIYDVGFSDEIQFIVMEYIDGITLKEFIEQQGVLRWKDALHFVTQI
LRALQHAHDKGIVHRDIKPQNIMLFPDGTIKVMDFGIARFSRIDGKTLSDKTIGSVHYIS
PEQARGDMTDERSDIYSVGVMLYEMLTGRKPFDGENPVAIALKHMQEDPVPPREIMPSIP
EALEEIVMHAMERDPARRYQSAAEMIKDIDTFKLNPSVVFGYKNSPVPIPVADNNNKYFD
DEHSENYDDDEEYEDDDEENDDEEEEEEKKRSYVVPILLAVTVAVVIIAAFVIVGVVFKS
FSGSNGMHTGTVTLPNFVGKNIVQVEQDYKDKLKFDITEEYNDQYDEGIITFQGQAAGKS
VKEGFTVTLTVSKGKKMATIPDMVKKDGTVAESELKAAGFMVVKRDIWSEDIASGLVVKT
QPAAGEQYAVGATVALFVSKGPVETRVKVPSVVGLTEEKAVAMLKENKLKAEVKEIEHEG
DKGKVIEQDTDEGTYVERDTTVTIYVSTGETSPVEVTFSLPLPSGIHGSYSIDIYNNGNV
AYTQKIGSGESVAGGSVNVTVKGKKTETLTIFITNDENQQKCRYAVYDIDYDKQTATLSG
SLNESGLIDITPTTTTTTTTTTTTTTTTTTTEAPAPEPQEPDEQGQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggattctaatatcggcaaaaagctagacggcagatatgagataaccgaacttatcggc
gtgggcggaatggctgacgtttataaggcagttgacgttatggaaaaccgtactgttgcg
gtaaagatacttaagcctgagttttcacagaacgaggaatttctaagacgcttcagaaac
gagagcaaggctatagctgtactttctcaccctaatatcgtaaagatatatgacgtggga
ttttctgacgagatacagtttatcgttatggagtatatcgacggcatcacccttaaagag
tttatcgagcagcagggcgtgcttaggtggaaagacgctttgcactttgtaactcagata
ctccgtgctttgcagcacgctcatgacaagggtatcgttcacagagatatcaaaccgcag
aacataatgcttttccctgacggaactatcaaggtcatggattttggtatcgcaagattt
tcaaggatcgacggaaagacactttctgacaagactatcggttctgttcactatatctca
cctgagcaggcaaggggcgatatgacagatgaaagatctgacatatactctgtaggcgtt
atgctctatgagatgctcacaggcagaaagccttttgacggcgaaaatcctgtggctatc
gctctcaagcatatgcaggaggatccggttccgccaagagagatcatgccttctatccca
gaggctcttgaagaaatagttatgcacgctatggagagagatcctgcaagacgttatcag
tcagcagcagagatgataaaggatatagacacattcaagctcaatccatctgttgttttc
ggatataagaacagtcctgttcctatccctgtggctgataacaataacaaatattttgac
gatgagcatagtgagaactatgacgacgatgaagaatatgaggacgatgacgaagaaaac
gatgacgaggaagaagaggaagaaaagaagcgttcttacgttgttccaatactccttgct
gtgacagttgcggtagttatcattgcagcgttcgttatcgtaggagttgtattcaagtca
ttcagcggttcaaacggtatgcacacaggcacagttacactgccaaactttgtgggcaag
aatatcgttcaggttgagcaggattataaggataagcttaaatttgatatcaccgaagag
tataatgaccagtatgacgagggaataatcacattccagggtcaggcagcaggaaagtct
gttaaggaaggcttcacggtcacacttactgtaagtaagggcaaaaaaatggcaactatc
cctgacatggtgaagaaagacggcactgtggctgaaagcgagcttaaggctgcaggattt
atggtcgttaagagagatatatggtctgaggatatagcttcaggtcttgttgtgaaaaca
cagccggcagcaggcgagcagtatgccgtaggtgcgactgttgctttgtttgtaagtaag
ggtcctgttgaaacaagagtcaaagtaccaagcgttgtaggtcttacagaagaaaaggca
gttgcaatgctcaaggagaacaagctcaaggctgaggtcaaggagatagagcatgagggc
gataagggcaaggtcatcgagcaggatacagacgaaggcacatatgttgagcgtgacaca
actgttactatttacgtttcgaccggagaaacttcacctgttgaggtaacattctcactg
ccactcccaagtggtatccacggctcatattctatagacatctacaataacggcaacgtt
gcatatacacagaagatcggtagtggagaatctgttgcaggcggttctgtaaatgtaacg
gtaaagggcaagaagacagaaactctgactatcttcatcacaaatgacgaaaatcagcag
aagtgccgttatgcagtatatgacatagattatgataagcagacagctactcttagcgga
agcctgaatgaaagcggtctgatcgacattactccgacaacgaccacaacaactacaact
acgaccacaacaactactacaactaccactactgaagcacctgcaccggagcctcaggag
ccagacgagcagggtcagtag

DBGET integrated database retrieval system