KEGG   Ruminococcus bicirculans: RBI_I01995Help
Entry
RBI_I01995        CDS       T03158                                 

Definition
(GenBank) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rus  Ruminococcus bicirculans
Pathway
rus00040  Pentose and glucuronate interconversions
rus00051  Fructose and mannose metabolism
rus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RBI_I01995
   00051 Fructose and mannose metabolism
    RBI_I01995
Enzymes [BR:rus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     RBI_I01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH Sacchrp_dh_NADP F420_oxidored 2-Hacid_dh_C TrkA_N AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCO05693
UniProt: W0U841
LinkDB All DBs
Position
I:complement(2155839..2156912)
Genome map
AA seq 357 aa AA seqDB search
MKSLINIPEKMKALVLYGVGDLRVTEVDVPKLEKGTVLLKIKACGICSSDMPRCFVTGTY
HFPTIPGHEFSGQIVAVGDDVDESLLGKRSCVFPMLPCKHCKACKMEEYAQCSGYSYFGS
RQDGAWAEYLVVPVWNLVPFDDTLDYKTAALCEPAAVSMHAVNIGDIKEGQNVVIIGTGT
IGFMIALFAKERTKTGKVVIAGRSKNKLEYAKKLGFDVVDTSVDDLPAQVKKIIGIDGAD
VTFEAVGSNEAIASAIESTGALGSIVLVGNPSTDLILPKNIYWSILRKQITVKGSWNSSY
NSRVNDWKKALEVFEHSDVNFADLITHTFTIEENEKAFSAIRNTGEFTLKVMFTFDD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaataaacatacccgaaaagatgaaagcacttgtgctttatggcgtgggc
gacctgagagtaactgaggtagacgtgccaaagcttgaaaaaggcaccgtattgctgaaa
ataaaggcgtgcggaatttgttcaagcgatatgccaagatgctttgtaacaggaacttac
cacttcccgaccatacctggtcatgagttttcaggtcagatagttgcagttggcgatgac
gttgacgaaagccttctcggcaaacgttcctgcgtgttccctatgctcccttgcaagcat
tgtaaagcctgcaaaatggaggaatatgcacaatgctcaggctatagctatttcggttca
agacaggacggtgcatgggctgagtacctcgttgttccagtatggaacttagttccgttc
gacgataccctcgattataaaacagcagcgctctgcgagcctgccgctgtttcaatgcac
gctgtaaatatcggcgacatcaaagagggtcagaacgttgttatcataggcacaggtaca
ataggctttatgatagccctctttgcaaaagagagaacaaagaccggtaaggtggttatc
gcaggccgttcaaagaataagcttgagtatgcaaagaagctgggctttgacgttgttgat
acaagcgttgacgatctccctgcacaggtgaagaagataataggtatcgacggagcagac
gtaacatttgaagctgtcggctcaaacgaagctatcgcttccgctatcgagtcaacaggc
gctcttggcagtatcgttctcgttggcaacccgtcaacagaccttatcctgcctaagaat
atctattggtcaatactgagaaagcagataacagtcaaaggctcatggaattccagctat
aacagcagagtgaacgattggaagaaagcccttgaagttttcgagcatagcgacgtaaac
tttgccgatcttatcacacatacattcacaatagaggagaacgaaaaggcattctccgct
atcagaaacacaggcgagttcaccttaaaggtaatgttcacatttgacgattaa

DBGET integrated database retrieval system