KEGG   Candidatus Rickettsiella viridis: RVIR1_06770Help
Entry
RVIR1_06770       CDS       T05765                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00020  Citrate cycle (TCA cycle)
rvi00190  Oxidative phosphorylation
rvi00650  Butanoate metabolism
rvi01100  Metabolic pathways
rvi01110  Biosynthesis of secondary metabolites
rvi01120  Microbial metabolism in diverse environments
rvi01130  Biosynthesis of antibiotics
rvi01200  Carbon metabolism
Module
rvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RVIR1_06770 (sdhA)
   00650 Butanoate metabolism
    RVIR1_06770 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RVIR1_06770 (sdhA)
Enzymes [BR:rvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RVIR1_06770 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RVIR1_06770 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA Thi4 DAO FAD_binding_3 FAD_oxidored Lycopene_cycl NAD_binding_7 NAD_binding_8 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BBB15174
UniProt: A0A2Z5UUM3
LinkDB All DBs
Position
713452..715218
Genome map
AA seq 588 aa AA seqDB search
MAIPTYTFDAVIVGAGGAGMRAALQLANSGQKVALISKVFPTRSHTVSAQGGITCALGNA
HEDDWRWHMYDTVKGSDYLGDQDSIEYMCKTGPEAVYELEHMGLPFSRMDSGKIYQRPFG
GQSKHFGGDQAARTCAAADRTGHALLHTLYQQNVKAKTHFFNEWYAIDLVKTAKGQVAGL
TALCIETGEVVFFHSRATILATGGAGRIFQSTTNALINTGDGIGMALRAGFAVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLINKNGERFMERYAPHAKDLASRDVVARAMALELRAG
NGFDPHGTDYVKLKLDHLGADLIKKRLPGIRELAITFAHFDPITTPIPVVPTCHYMMGGL
PTNVHAQVLTLNSQGHDQVVEGLYAAGECACVSVHGANRLGGNSLLDLVVFGRSAGLHVE
QSLQKDLPLLSVNPDDLEAGLTRLNRWNNTDKGESVVEIRQAMQKSMQNDFGVFRTENYM
QEGLAKLTELRERLQHAALTDRSQVFNTARVEALELDNLMEVAYASAVSALTRQESRGAH
SREDYPKRDDKNWLKHLLYFSKDAQVAYRAVNMKPESMAPMELKERVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacccacttatacctttgatgcagtgattgttggtgccggcggtgccggtatg
cgtgccgccttacaattagcgaactcgggtcaaaaggtggcgctgatttctaaggtgttt
cctacacgttcgcataccgtttctgcgcaaggtggaattacctgtgccttaggcaacgcc
cacgaggatgattggcgttggcatatgtacgatacagtaaaaggttctgattatttaggt
gatcaggattctatcgaatatatgtgtaaaacgggtccagaggcggtatatgagctggaa
cacatgggcttaccgttctcacgtatggattcaggtaagatttatcaacgtccttttggt
ggccaatctaagcattttggtggtgatcaagccgctcgtacctgtgcggcggcggatagg
acaggtcatgccttattacatacactgtatcaacaaaatgtaaaagcaaaaacccatttt
tttaatgaatggtatgcgattgatttagttaaaacggcgaaaggacaggtggcgggttta
actgctttatgtattgaaaccggtgaagtcgttttctttcatagccgggcgacgatctta
gccactggcggcgcgggacgtatttttcaatccactaccaacgctttgataaacaccggt
gatgggattggtatggcgttgcgtgcgggctttgcggtacaggacatggaaatgtggcaa
tttcatccgacgggtattgcgggtgccggcgtgttagtgaccgaaggctgtcgaggtgaa
ggcggttatttgataaataaaaatggcgaacgtttcatggaacgttatgcaccgcatgct
aaagatttagcctctagggatgtggtagcgcgggcgatggccttagaattgcgtgcaggc
aatggctttgatccgcacggtacagattatgtgaaattaaaattagaccatttaggtgcc
gatctgattaagaagcgtttacccggcatacgcgaattagccattacctttgcccatttt
gatccgattaccacaccgattcccgtcgtaccgacttgccattatatgatgggcggacta
cctactaatgtgcatgctcaagtgctaacgctaaactcacagggccatgatcaagtcgtt
gaaggcttgtatgcagcgggtgaatgcgcatgcgtctctgtgcatggtgctaatcgatta
ggtggtaactcgctactcgatctcgtggtatttggtcgttctgccggattacatgtagaa
cagtcattacaaaaagatttacctttactgtcggtaaacccagacgatttagaagcggga
ttaacccgactgaatcgttggaacaacaccgataaaggtgaaagtgtggttgagattcgt
caagcgatgcaaaagagtatgcagaacgattttggtgtatttcgaaccgaaaattacatg
caagaaggcttagcaaaactgactgaactcagagaacgtttacaacatgcggcattaacg
gatcgtagccaagtgttcaatacggcaagagtggaagcgcttgaattagataatttaatg
gaagtggcgtatgcctcggctgtttcagcgttaacgcgccaagaaagtcgtggtgcacac
agtcgcgaagattatccaaagcgagacgataaaaattggctgaaacatttactgtatttt
tctaaggatgctcaggtcgcttatagagcagtgaatatgaaacctgaaagtatggcgccg
atggaattaaaagagagagtttattaa

DBGET integrated database retrieval system