KEGG   Candidatus Rickettsiella viridis: RVIR1_06780Help
Entry
RVIR1_06780       CDS       T05765                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00020  Citrate cycle (TCA cycle)
rvi00190  Oxidative phosphorylation
rvi00650  Butanoate metabolism
rvi01100  Metabolic pathways
rvi01110  Biosynthesis of secondary metabolites
rvi01120  Microbial metabolism in diverse environments
rvi01130  Biosynthesis of antibiotics
rvi01200  Carbon metabolism
Module
rvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RVIR1_06780 (sdhB)
   00650 Butanoate metabolism
    RVIR1_06780 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RVIR1_06780 (sdhB)
Enzymes [BR:rvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RVIR1_06780 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     RVIR1_06780 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_4 Fer4_16 Fer4_9
Motif
Other DBs
NCBI-ProteinID: BBB15175
UniProt: A0A2Z5UVU2
LinkDB All DBs
Position
715439..716137
Genome map
AA seq 232 aa AA seqDB search
MQFSIYRYDPDKDKKPYMQDYTLALEAGQDMMLLDALEALKAQDQTLSFRRSCREGVCGS
DGMNINGKNGLACVTQLSSLKSPIVLRPLPGLPVIRDLVVDMEPFYRQYEKAQPYLINDK
EPPAKERLQSPEEREQLDGLYECILCACCTSACPSYWWNPDKFLGPAALLWLCRFLVDNR
DEAKEQRLAELNDLFSLFRCRTIMNCTTVCPKGLNPAKAIAHVRTMLLKEET
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttctatttaccgttacgatcccgataaagataaaaaaccgtatatgcaagac
tatacgctggcattagaagcgggtcaggatatgatgttgctggatgctttagaagcattg
aaagcacaagatcaaacgctttcttttcgtcgttcttgccgtgaaggggtctgtggatca
gacggtatgaatattaatggaaaaaatggcttagcctgtgtgacacaactttcaagcttg
aagtcgcctatcgtattaaggcctttacctggattgccggtcattcgtgacttagtggtg
gatatggagcctttttatcgtcaatatgaaaaagcacaaccttatttaattaatgataaa
gaaccaccggctaaagagcgtttacagtcccctgaagagcgagaacaattggatggtctg
tatgaatgtattttgtgtgcctgctgtaccagtgcctgtccttcttattggtggaatccc
gataaatttttaggaccggcggcattattatggctgtgtcgatttttagttgataatcgt
gatgaagccaaagagcagcgcctggcggaactgaatgatttatttagtttattccgttgc
cgtactattatgaattgcacgacggtctgccctaaaggtttaaacccggctaaagcgatt
gctcatgtcagaaccatgctgttaaaagaagaaacctaa

DBGET integrated database retrieval system