KEGG   Candidatus Rickettsiella viridis: RVIR1_07670Help
Entry
RVIR1_07670       CDS       T05765                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00480  Glutathione metabolism
rvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RVIR1_07670 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rvi02000]
    RVIR1_07670 (gst)
Enzymes [BR:rvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RVIR1_07670 (gst)
Transporters [BR:rvi02000]
 Other transporters
  Pores ion channels [TC:1]
   RVIR1_07670 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Glutaredoxin2_C GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BBB15256
UniProt: A0A2Z5UUD0
LinkDB All DBs
Position
complement(806270..806878)
Genome map
AA seq 202 aa AA seqDB search
MKLFYSPGACSLSPHIVLREIGLDFTLEKVDLAQKKTELGTNYLTINPKGKVPALLLDDG
SLLTEGVAIVQYLADQLPSCNLIPPLDSLLRYHTIEWLSYISTELHKGFSPLFNPKTPEE
YKIIVRENLDKQFNYLDTALKENQYLQNDHFSVADAYLFTILRWAVAMKFDIHQKKYLGA
YFDRVAMRPAVDAALIEEGLKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattttatagtccgggtgcttgttcgttatccccccatattgtattacgtgaa
ataggactagatttcaccttagagaaagtcgatttagcgcaaaagaaaactgaattaggt
acaaactatctgaccatcaacccaaaaggcaaagtgcctgcacttttattggatgatggt
agtttactgactgaaggggtggcaatcgtgcaatatttagcggaccagctaccaagctgc
aacttgattccaccgcttgatagtttattacgctaccataccattgaatggcttagttac
atctcgacagagctgcataagggttttagtcccttgtttaacccaaaaacaccagaggaa
tataagataatcgtgcgcgaaaatctggataagcaattcaattacctcgatactgcatta
aaagaaaatcagtacctacaaaacgatcacttcagtgtagcagatgcgtatttgtttact
attttgcgttgggcagttgctatgaagtttgatattcaccaaaaaaaatatttaggcgct
tattttgaccgcgttgcgatgcgtcccgctgtggatgcagcgcttattgaagaaggcctt
aaaaaataa

DBGET integrated database retrieval system