KEGG   Candidatus Rickettsiella viridis: RVIR1_12560Help
Entry
RVIR1_12560       CDS       T05765                                 

Gene name
ponA
Definition
(GenBank) fused penicillin-binding protein 1a: murein transglycosylase murein transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00550  Peptidoglycan biosynthesis
rvi01100  Metabolic pathways
rvi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RVIR1_12560 (ponA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RVIR1_12560 (ponA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rvi01003]
    RVIR1_12560 (ponA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
    RVIR1_12560 (ponA)
Enzymes [BR:rvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RVIR1_12560 (ponA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RVIR1_12560 (ponA)
Glycosyltransferases [BR:rvi01003]
 Polysaccharide
  Bacterial polysaccharide
   RVIR1_12560 (ponA)
Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RVIR1_12560 (ponA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: BBB15712
UniProt: A0A2Z5V5M3
LinkDB All DBs
Position
1329754..1332195
Genome map
AA seq 813 aa AA seqDB search
MPLIMKKRPSVLRNLLLMLISLFITLIVVASLVYLYLDKQLPDVDELKSVQLPIPMRIYT
SEGQPIAEFGELHRNLVRLNEVPTLMVKAFLATEDQRFLEHHGVDFYGLLRAASELLITG
TKVQGGSTITMQVARNFYLSREKTFLRKFTEILLSLKIEREFSKDQILELYLNKIYLGNR
AYGIAAAAQVYFDKALNQLTLPEMATIAGLPKAPSAINPIVNPIAARQRRDHVLARMFEL
GYISKPVYETAIQTPMQTRPDTETSGMLKAPYVAEMVRDMMYKSFGDDIYTKGYNVYTTL
NATQQIAANNALSKALFAYDRRHGYRGPEKNIGPLDPKKLALALNTLHRIPSVNGLQAAI
VTLVTNEGVMALLANHQAILIPWTGLAWTIPQLDTTQLTAPPEALKDKVHIGDIIRVQNQ
NNIWQLAQIPKVQGALIALNPQNGAISALVGGFDYNLSKFNRVIQAERQPGSGFKPFIYA
AALAKGYTLANVFNDAPLVFDIPGRDEPWRPQNDNHIFSGPTRLRVALAKSINLVSVRLL
QAIDVPYVLSYAKRFGFNAKKLPRNLSLALGTGEVTPIELARAYAVFANGGYRITPYLID
HITNEQGDVIYQAEPKIACKDCLTGKIETPAPNAKDNPYAPQAIPADIAFLTTSALKDVI
RYGTGYQARSLGRSDLAGKTGTTSDYVDTWFSGFNSDLVATVWIGFDQPTSVLEYGAKTA
LPMWIDFMRVALQGKPERTMPQPPDIITASIDPMTGYLLPEGTPGSILEYFRQDNLPKTP
SEEDLSNFPSPDNTDNQTGTESEPANIKQNPLI
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcattatgaaaaaacgcccttctgttttacgcaatctactgttgatgctaata
agcctcttcattacgcttattgtagtggccagcttggtctatttatatctagataaacag
ctacctgatgtcgatgaattaaaatctgtacagctacctattcctatgcggatttatacc
agcgagggtcaaccgattgctgaattcggggaactacatcggaatttggtcagattaaat
gaagtaccgacattaatggttaaagcttttttagccacggaagatcaacgttttttagaa
catcatggtgtcgatttttatggtttattacgtgccgctagcgaattactaataacgggc
acaaaagtgcaaggtggtagtacgatcaccatgcaagtagcgcgtaacttttatttgtca
cgcgaaaaaacatttttacgtaaatttactgaaattcttttatccctcaaaatagaacgt
gagtttagcaaagatcaaattctagaactttatcttaataaaatttacttaggtaatcga
gcctacggaattgctgccgctgcacaagtttattttgataaagcgcttaatcaacttaca
ttgcctgaaatggcaacgattgcaggcctacctaaagcaccctccgctattaatcctatc
gttaatcctattgctgcaaggcaacgacgtgaccacgtcttagcccgtatgtttgaactc
ggttatatatcaaaaccggtttatgaaaccgctattcaaacacctatgcaaacacgccct
gatactgaaaccagtggcatgttaaaagcaccgtatgtcgctgaaatggttcgcgacatg
atgtataaaagttttggcgatgatatttatacgaaaggatataatgtttatacaacactt
aatgcaactcaacaaatagccgcgaataatgccttatctaaggcgttatttgcctatgat
cgtcgacatggctatagaggacctgaaaaaaatataggtcccttagatcctaaaaagctg
gcgcttgcattaaatacattgcatcggatcccttctgttaatggcttacaagctgccatt
gttacactcgtaacaaatgaaggcgtcatggctttattagcgaatcatcaggctattctt
attccttggacgggtcttgcttggacaatacctcaattggataccacgcaactcactgct
cctcccgaagctttaaaagataaagtccatattggcgatatcatacgtgtgcagaatcaa
aacaatatctggcaacttgcgcaaatacctaaagtacaaggcgcattgattgctttaaat
cctcaaaatggtgccataagcgcattagtaggtggatttgattataacttaagtaagttc
aaccgcgtcattcaagctgaacgacaacccggctctggctttaaaccttttatttatgcc
gctgccttagctaaaggttatacgcttgctaatgtatttaatgatgcacctttggtattt
gatatacctggacgcgatgagccttggcgcccacaaaatgataaccacatttttagcggc
cccactcgtttacgtgtagctttagcgaaatctattaatctggtttcagtccgtttattg
caagccattgatgtgccttatgtcttatcttatgcaaaacgctttggattcaatgcaaaa
aaattaccgcgcaatctttcgctcgcattaggcaccggtgaagtaacacctatcgaatta
gcacgtgcttatgccgtgtttgctaatggcggttatcgtattacaccttatttgattgat
catattaccaatgaacaaggggacgttatttaccaagccgaacctaaaatagcgtgtaaa
gattgtttgacgggtaaaattgaaacaccagcacccaatgcaaaagataatccttatgca
ccacaagctatccctgctgacattgcttttttaacgacatccgcgctaaaagatgttatt
cgctacggtacaggctatcaggcaagaagcttaggtcgtagtgatcttgccggaaaaaca
ggaacgacgagtgattatgtggacacctggttttctggttttaatagtgatttggttgcg
actgtttggataggctttgatcaacctacgtctgtgcttgaatatggcgcaaaaacagcc
ttaccgatgtggatagactttatgcgcgtcgcactgcaaggtaaacctgaaagaacaatg
cctcaaccacctgatatcattactgctagtatcgatccaatgacaggttatttacttcca
gaaggtacacccggttctattttggaatatttccgtcaagataatttaccaaaaacaccc
agcgaggaagatctgtcaaacttcccatcgcccgacaacacggataatcaaacgggcact
gaatcagaacccgctaatataaaacagaacccgctaatataa

DBGET integrated database retrieval system