KEGG   Candidatus Rickettsiella viridis: RVIR1_12970Help
Entry
RVIR1_12970       CDS       T05765                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00471  D-Glutamine and D-glutamate metabolism
rvi00550  Peptidoglycan biosynthesis
rvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RVIR1_12970 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RVIR1_12970 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
    RVIR1_12970 (murC)
Enzymes [BR:rvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     RVIR1_12970 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
 Precursor biosynthesis
  Amino acid ligase
   RVIR1_12970 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C 3HCDH_N Methyltransf_12 Transglut_core3 Lactate_perm
Motif
Other DBs
NCBI-ProteinID: BBB15746
UniProt: A0A2Z5UVV5
LinkDB All DBs
Position
1371471..1372889
Genome map
AA seq 472 aa AA seqDB search
MKNPFVDHQMGRIQHLHFVGIGGAGMGGIAEILLNEGYTVSGSDLQENSMTQHLQQLGAQ
FNRGHKAKHIDKADVIIYSSAVPKDNVEIMKARQTHIPVVPRALMLAELMRFRYGIAVAG
THGKTTTTSLVASLLREAGLDPTFVIGGCLNSTNTHARLGSGRYLVAEADESDASFLYLK
PMVAIITNIDADHMGTYDGNFQRLKQSFIEFLRHLPFYGLAIVCVDDPIIRSILPEVMRP
VITYGFSKDADIRITSFKQKEIKNHFSVLRKNQKPLNITLNLPGQHNALNAVASIAVATE
LNIADDVIQTALAKFSGVDRRFQILGEFCVKKGRVLLIDDYGHHPSEIAATLKTIRAAWP
DRRLVMTYQPHRYTRTRDLFNEFVTVLADVDHLLLLDVYSAGETAIPGADSLALSEHIRQ
RSDLNPTVVADKKHLSRNLHDILENNDVLLLQGAGDIGSIAQQLALSEFSMD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacccttttgtagaccaccaaatgggccgtattcagcatcttcatttcgttggc
atcggcggtgctggcatgggcggtattgccgaaatcctactcaatgagggttacacggtt
tcgggctctgatctacaagaaaacagcatgacccaacatttgcaacagttaggtgcacaa
ttcaaccgtggccataaagcgaaacatattgataaagcggatgtgatcatctattccagt
gccgtgccaaaagataatgtagaaattatgaaagcgcggcaaacgcatatcccggtggtc
cctagagccttaatgcttgctgaattaatgcggtttcgctatgggattgctgtcgcaggc
acgcatggaaaaacaaccaccaccagtttggtagctagtctattaagagaagcaggactt
gatcctacctttgtgattggtggctgccttaatagcactaatacgcatgcacgcttaggt
tcaggccgctatttagttgctgaagccgatgaaagcgacgcttcttttctttatttaaaa
cctatggtggctatcatcaccaatattgatgccgatcacatgggtacttatgacggaaat
tttcagcggctcaaacaaagctttatagaatttttacgtcatttacccttttatggctta
gcgattgtctgtgtagatgatccgattatacgttctattcttcctgaagtgatgcgtcct
gttattacatacggtttcagtaaagatgccgatatacgaattacttcttttaaacaaaaa
gaaattaaaaatcactttagcgttttacgcaaaaatcaaaaaccattaaatatcacctta
aatttaccgggacaacataatgccttgaatgctgtcgcaagtattgcggttgcgactgaa
ttaaatattgctgacgacgtgattcaaactgctttagctaaatttagtggtgttgatcga
cgttttcaaatcctcggtgaattttgtgttaaaaaagggcgggttttattaatcgatgat
tatggtcatcatcctagtgaaattgcggctactttaaaaacgattcgcgcagcttggccc
gatcgacgcttggtaatgacttatcaaccacaccgttacacgcgcacacgtgatttattt
aatgaatttgtcacagtattagcggatgtagatcatttgctgttattagatgtgtattcg
gccggagaaacagctattcctggtgctgatagcctggccctatcagaacacattcgccaa
cgctccgatttaaatcctacggttgttgccgacaaaaaacatttatcacgcaatttgcac
gacatccttgaaaataacgatgtacttttactacaaggtgcaggtgacattggcagtatt
gcacaacaacttgccctatccgaattcagtatggattaa

DBGET integrated database retrieval system