KEGG   Candidatus Rickettsiella viridis: RVIR1_13890Help
Entry
RVIR1_13890       CDS       T05765                                 

Gene name
mrdA
Definition
(GenBank) cell elongation specific D D-transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00550  Peptidoglycan biosynthesis
rvi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RVIR1_13890 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RVIR1_13890 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
    RVIR1_13890 (mrdA)
Enzymes [BR:rvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RVIR1_13890 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:rvi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   RVIR1_13890 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BBB15834
UniProt: A0A2Z5UWK9
LinkDB All DBs
Position
1485252..1487300
Genome map
AA seq 682 aa AA seqDB search
MLKSINRFKNTRQEHGLFKRRAFAILIGIGFLTLVLLGRLIYLQLFQHNLYTTLARQNQL
GLIPVEPNRGLIYDRNGVLLAENKPIFNLVITPDLVSHMDETITTLSKIIKIDSEDLKQF
ERQRRLHHRFEPVPLRVKLTEEEVAKFSIERYRFPGVSIQAEMIRYYPRGNAFAAIVGYM
GRINEKELQTVDPVNYSASNFIGKTGVEKYYEAQLHGTVGYQQVETNVHGQIVRVLRQTQ
PISGRSLVLTIDSGLQELAQRALGQQKGAVVALDPRNGEILAFVSSPSFDPNLFVSGIKQ
TDYDALKNAPGNPLYNRALRGAYHPGSTIKPFISIEALRDNVITPSYTIHDTGEFQINGK
GRIYHNFRRHSYGDVNLLKALTVSSDIYFYNLSMRMGINRIDSILHQFNFGSPIGIDLPD
ESGGVLPTPEWKKKSYGESWYPGDTLNCGIGQGYLLVTPLQLAYAVSTLANWGERWKPHV
VLSWRSGNGAITSIEPERLAPITDVPKPILSFIRTAMQHVVNAPGGTAERFFPGAPYTLA
GKTGTAQVFSMKNNERYDSKTIATKLRDDSLFITFAPVEEPKIALAIIVQNSVTPAAEIA
RRLLDHYLIPPSPIPTITSQEAIPISSPTPAEPSNAAQSKEKPSEPLDPSPEADKNALTP
QRSHQDEDSNDQEGEENETPEE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtcgataaataggtttaaaaacactcgtcaggagcacggattatttaagcga
agggcatttgccattctgataggaataggatttttaacgcttgtcctattgggtcgttta
atttatctacaactctttcagcataacctgtatacgaccctggctcgacagaaccagctc
ggcctgatccccgttgaacctaatcgcggccttatttatgacagaaacggtgttttactg
gcagagaataaaccaattttcaatcttgttattacgcctgatttagtcagccacatggat
gaaaccatcactacgctctctaaaattatcaagattgactcagaggacctcaaacaattt
gagcgccaacggcgcttacatcatcgctttgaacccgtccctctgcgcgttaaattaact
gaagaagaagttgctaaattttccattgagcgttatcgctttcccggcgttagcatacaa
gcagaaatgattcgttattacccaagaggcaacgcttttgccgctatagtcggttatatg
ggccgaattaatgagaaagaactacaaactgttgaccctgttaactatagtgccagcaac
tttatcggaaaaacaggtgtagaaaagtattacgaagcacaattgcatggcacagtagga
taccagcaagttgaaacgaatgtgcatggtcaaatcgtacgtgttttaagacaaactcaa
cctatttctggtagaagcctcgtattaaccattgatagtggtctacaagaattagcacaa
cgagctttaggccagcagaaaggggctgtcgttgcgctagatccacgtaacggggaaatt
ttagcttttgtcagcagtcctagctttgacccgaacctctttgttagcggcattaaacaa
acagattatgatgcattaaaaaatgcaccaggcaaccctttatataatcgagccttacgc
ggtgcctatcatccaggctcgacaattaagccttttatcagcattgaagccctaagggat
aatgtcattacaccctcttatacgattcatgatacgggcgaatttcaaattaatggtaaa
ggacggatttatcacaattttcgccgccattcctatggtgatgtcaatttactcaaggca
ttaaccgtttcttcagatatctatttctataatctaagtatgcgaatgggtattaatcga
attgacagtatcctccatcaatttaactttggctcacctataggcatcgacctgcctgat
gaaagtggtggtgtattacccactccagagtggaagaaaaaatcctatggggaatcctgg
tatcccggcgatacccttaattgcggtattggccaaggatatttattagtaacgcctctg
caattagcctatgcggtcagcacactcgcaaactggggagaacgctggaaaccgcatgta
gtattaagctggcgctcaggtaacggtgctatcacgtctatagagcctgagcgcttagcg
cccataaccgatgtacctaaacctatcttaagctttatccgtacggctatgcagcatgtt
gtcaatgctcctggcggaactgccgaacgctttttccctggtgccccctataccttggca
ggaaaaacaggaactgctcaagtttttagtatgaaaaacaatgagcgctatgactctaaa
acaatagctactaaactacgggatgattccctatttatcacctttgcccccgttgaggag
ccgaaaatagccctcgccattattgtgcaaaatagtgtaacaccggcggcagaaatcgct
cgtcggcttcttgatcactatttaattcccccttcacctatccccacgattacttctcaa
gaagcaatacctatatcttctcctactcctgctgaaccctcgaatgcagcacaatccaaa
gaaaaacctagcgagccattggatccttccccagaagctgataaaaacgccttaacgcct
caaagaagccatcaggatgaagacagcaatgatcaggagggcgaagaaaatgaaacccca
gaagaataa

DBGET integrated database retrieval system