KEGG   Rubrobacter xylanophilus: Rxyl_0021Help
Entry
Rxyl_0021         CDS       T00368                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rxy  Rubrobacter xylanophilus
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rxy01001]
    Rxyl_0021
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Rxyl_0021
Protein kinases [BR:rxy01001]
 Serine/threonine kinases: Other
  Bacterial family
   Rxyl_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal DUF3040 RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ABG03002
UniProt: Q1B026
LinkDB All DBs
Position
complement(21654..23654)
Genome map
AA seq 666 aa AA seqDB search
MQQLVDNRYRIVRRLGSGGMADVYLAHDDILDRDVALKVLSSHYAADAEFVERFKREAQS
AAALAHPNIVSIYDRGEAEDGTYYIAMEYLPGGTLKDRILRKGALPPKTAAAVALQIAEA
LKAAHQRGVVHRDIKPHNILITESGDLKVTDFGIARAASSSTMTRTGAVLGTAHYISPEQ
AMGEPVGPPSDLYSLGVVLYEMLTGQLPYDADTPIGIAMKHVNGHLRPPREVNPAVPEGL
DAITVRLLAKDPKERYQSADELMEDLERFLRGEDPAAAAPTAVMGRVGRDETAPTRVQPA
VGREGKRRRWPLVALLLAALLALLGLGGYQLLLEDQAGGRDAPPRMAVPDLQGMSLEEAQ
RRYGDDFDIVEGERRDGPREAGTILEQDPPPGERLERGSEISVAVASGENEVPAVVDSPA
DEARSALSEAGFEVKVEERESEEEQEGLVLEQSPEGGSTAEVGSTVTIAVGTGVPTVVVP
DIPYGYTAEQSRQVLEQAGLRLGSVGYAPNSQVAEGGIIDQNPPPGTEVEEGTAVDIVLS
SGPPQTEVPDVVGLDVNVAVQRLSGAGLGYALIERQSGEPEGTVLSTSPPAGSTVDQGTQ
VRVVYSVGRPEPRPEPTTARPPEEQGGPQGGGGQGRDRGRDETQSRPAPAAGPGERRPPS
GEDEGD
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagctcgtagacaaccgctaccgcatcgtgcggcggctgggcagcggggggatg
gccgacgtctacctcgcccacgacgacatcctggaccgggacgtggccctgaaggtcctg
agcagccactacgccgccgacgcggagttcgtcgagcgcttcaagcgggaggcccagagc
gccgccgccctcgcccacccgaacatcgtctccatctacgaccggggcgaggccgaggac
ggcacctactacatcgccatggagtacctgcccggcgggacgctgaaggacaggatcctc
cgcaagggcgccctgccgccgaagacggcggccgcggtggcgctgcagatcgccgaggcc
ctcaaggcggcccaccagcgcggcgtcgtccaccgggacataaagccgcacaacatcctc
atcaccgagtcgggggacctgaaggtcacggacttcgggatcgcccgggcggcctcctcc
tcgacgatgacccggaccggggcggtgctgggcacggcccactacatctcgcccgagcag
gcgatgggcgagccggtgggcccgccgagcgacctctactctttaggggtcgtgctctac
gagatgctcaccgggcagctcccctacgacgccgacacccccataggcatcgccatgaag
cacgtcaacggccacctgcgcccgccgcgggaggtgaacccggccgtgccggaggggctc
gacgccataacggtgcggctgctcgcgaaggacccgaaggagcgctaccagagcgccgac
gagctgatggaggacctggagcgctttctgcgcggggaggacccggcggcggccgccccc
acggcggtgatgggccgggtcgggcgggacgagaccgcccccacccgggtccagcccgcc
gtgggccgggagggaaagcggcggcgctggcccctcgtcgccctgctgctggcggcgctg
ctcgcgctgctgggcctcgggggctaccagctcctcctggaggaccaggccgggggccgg
gacgcgccccccaggatggcggtcccggacctgcaggggatgagcctcgaggaggcgcag
cggcggtacggggacgacttcgacatcgtcgagggggagaggcgcgacgggccgcgggag
gccggcaccatcctggagcaggacccgccccccggcgagcggctggagcggggctcggag
atctccgtggccgtcgccagcggcgagaacgaggttcccgcggtggtggacagccccgcg
gacgaggcccgctcggcgctctcggaggccggcttcgaggtgaaggtcgaggagcgggag
agcgaggaggagcaggaggggctggtcctcgagcagagccccgaaggggggagcaccgct
gaggtgggctccaccgtcaccatcgcggtcgggaccggagtccccacggtggtggtgccg
gacatcccctacggctacaccgccgagcagtcccggcaggtgctggagcaggcgggcctg
aggctcggcagcgtgggctacgcccccaacagccaggtggccgagggcgggatcatagac
cagaacccgccgccgggcaccgaggtggaggagggcaccgcggtggacatcgtgctcagc
tccgggccgccgcagaccgaggtgcccgacgtggtcggcctcgacgtgaacgtcgcggtt
cagcggctgagcggcgcgggcctgggttacgccctaatcgagcgccagagcggcgagccg
gaggggacggtgctctccacgagcccgcccgccggctccacggtggaccagggaacgcag
gtgcgggtggtctacagcgtgggccggccggagccccgcccggagcccaccaccgcccgt
ccgccggaggagcagggcggcccacagggagggggcggccagggccgggacagggggcgc
gacgagacccagagcagaccggcccccgcggcaggccccggggagcgcaggccgccgtcc
ggggaggatgagggcgactga

DBGET integrated database retrieval system