KEGG   Rubrobacter xylanophilus: Rxyl_0837Help
Entry
Rxyl_0837         CDS       T00368                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy00270  Cysteine and methionine metabolism
rxy00680  Methane metabolism
rxy01100  Metabolic pathways
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
rxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Rxyl_0837
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_0837
   00270 Cysteine and methionine metabolism
    Rxyl_0837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rxy04147]
    Rxyl_0837
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Rxyl_0837
    1.1.1.399  2-oxoglutarate reductase
     Rxyl_0837
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rxyl_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ABG03805
UniProt: Q1AXS3
LinkDB All DBs
Position
874790..876373
Genome map
AA seq 527 aa AA seqDB search
MRVLVTEKLAERGVELLRREFEVDVLLGLSPGELLERIGEYDGLIVRSATKVTAEVIEAA
GRLKAIGRAGIGVDNIDIEAATKRGILVANAPESNTVAAAEHTLGLMLAVARRIPAADAS
LRRGEWNRAAFKGVEVAEKTLGLVGLGHVGSIVARGALGMGMRVLAYDPYVSEERMRSMN
VERAGSLEEIFEEADFVSLHVPRTPQTTGMVGEEELARMKPTAYLINVARGGIVDETALY
NALKQGEIAGAALDVFAEEPTTDSPLFALPNVVVTPHLGASTAEAQDRAGVTAAEQVAAA
LRGEVPIHAINAPVPAGEGAEFVSQFAGLCETLGRLLYQLTDRPGSRLKIEYRGEIGAYD
TRLLDVSVQKGLLSRMVHEPLNYVNTPILAKERGLKVETSKTSESSDYTNLVVVRIESNG
GESVVSGTLTGPRMQPRLVEALGYTLDIVPERHMLFIRNEDVPGMIGKVGTILGEHGINI
GNMAVGRGEPGSRAAMAVTVDEPVPPEVVESLLNIPGFNDARAVTLY
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
ttgagggtgctcgtaaccgagaagctcgccgagcgcggcgtagagctcctgcggagggag
ttcgaggtcgacgtgctcctcggcctctcgcccggcgagctgctggagaggatcggggag
tacgacgggctgatcgtccggagcgccaccaaggtgactgcggaggtcatagaggccgcc
gggaggctcaaggccatcgggcgcgcggggatcggggtggacaacatagacatcgaggcg
gccaccaagcggggcatcctggtggccaacgccccggagagcaacacggtggccgccgcc
gagcacaccctggggctgatgctcgccgtcgcccggcgcatcccggccgccgacgcctcc
ctgcggcgcggggagtggaaccgcgccgccttcaagggcgtggaggtcgccgagaagacg
ctcggcctggtcggcctggggcacgtgggctccatcgtcgcccgcggcgccctggggatg
gggatgcgcgtcctcgcctacgacccctacgtctccgaggagaggatgcgctcgatgaac
gtggagcgggcgggctcgctggaggagatcttcgaggaggccgacttcgtctcgctgcac
gtcccccgcactccccagaccacgggcatggtgggcgaggaggagctggcgcggatgaag
cccaccgcctacctgataaacgtggcccgcggcgggatagtggacgagaccgccctctac
aacgccctcaagcagggcgagatagcgggggccgcgctcgacgtcttcgcggaggagccg
accaccgactcccccctcttcgccctcccgaacgtggtcgtcaccccccacctgggggcg
agcaccgccgaggcccaggaccgggcgggcgtgacggcggccgagcaggtggcggcggcc
ctcaggggagaggtgccgatacacgctataaacgccccggtgcccgcgggggagggggcg
gagttcgtctcccagttcgccgggctctgcgagacgctggggaggctgctctaccagctc
acggaccggcccggcagccgcctcaagatagagtaccgcggcgagatcggggcctacgac
acccggctgctggacgtctcggtgcagaaggggctcctgtcccggatggtgcacgagccc
ctgaactacgttaacacccccatcctggcgaaggagcgggggctgaaggtcgagacctcg
aagacctcggagagctcggactacaccaacctggtggtggtccgcatcgagagcaacggc
ggcgagagcgtggtgagcggcaccctcaccggcccccggatgcagccccggctggtcgag
gccctcggctacacgctggatatcgtcccggagcggcacatgctgtttatccgcaacgag
gacgtgccgggcatgatcgggaaggtcggcacgatcctcggcgagcacgggataaacatc
ggcaacatggccgtggggcgcggcgagccgggaagccgggcggcgatggcggtgaccgtg
gacgagccggtgcccccggaggtcgtcgagagcctcctgaatatcccgggcttcaacgac
gcccgggccgtcaccctctactaa

DBGET integrated database retrieval system