KEGG   Rubrobacter xylanophilus: Rxyl_1100Help
Entry
Rxyl_1100         CDS       T00368                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00340  Histidine metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01230  Biosynthesis of amino acids
Module
rxy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rxyl_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d NAD_kinase Epimerase_2
Motif
Other DBs
NCBI-ProteinID: ABG04066
UniProt: Q1AX12
LinkDB All DBs
Position
1134947..1136188
Genome map
AA seq 413 aa AA seqDB search
MRSRAARKFSTTPGTRDVLPPESTRLLDVQRRVLGRFRLHGFREVITPALEYAEVVEEAR
LRDSAFKLFDPDNQMLLLRPEMTTPIARLVSQRLRNAPPPFKLSYSLPVYRRSEVGRGQS
AEFHQAGVEVVGSASPGEDAGTIALLVEALEAAGLGPGEDFMVVLGQAAFYRGFLERSCP
EVAPALLSALAGKDLVRVEELSRRLPDAVAAGARGIPRLVGPASDGAVLEEAERYASGGG
GAALENLRAILELLGAHGRLEAVMLDLGLIGRHDYYTGAVYEVYAAGLGFTVANGGRYDN
LLRRFGEPLPATGFAISLERLVSVLPPERPAPLLVLVGEDAEAVRAARALRGEGVPVLHV
SGGLAPEEAERYARSVDARWVGYPAPGGVKLREVGEGGFWLLAVEEAARRVLG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccagggccgccaggaagttctccaccacgcccggcacccgcgacgtactgccg
ccggagtccacccggctgctcgacgtccagcggcgggtgctcggccgcttccggctgcac
gggttcagggaagtgatcacgccggccctggagtacgccgaggtggtggaggaggcccgc
ctgcgggactcggccttcaagctcttcgacccggacaaccagatgctgcttttgcgcccg
gagatgaccacccccatcgcccggctggtctcccagcgcctgcggaacgcccccccgccg
ttcaagctctcctacagcctgcccgtctaccgccggtcggaggtgggccggggccagagc
gcggagttccaccaggcgggggtggaggtcgtcgggtcggccagcccgggggaggacgcc
gggacgatagccctcctggtggaggcgctcgaggcggcggggctcgggccgggggaggac
ttcatggtcgtcctgggtcaggctgccttctaccggggctttctggagaggagctgcccg
gaggtcgcgccggcgctgctctcggcgctcgcgggcaaggatctcgtccgggtcgaggag
ctctcgcgccggctgcccgacgcggtcgccgccggggcgcgcggcataccgcgcctcgtc
ggcccggcctccgacggggcggtgctggaggaggcggagcgctacgcctccggcggcggg
ggcgcggcgctggagaacctgcgcgcgatcctggagcttttgggggcgcacgggcggctg
gaggccgtgatgctggacctcgggctcatcggccgccacgactactacacgggggcggtc
tacgaggtctacgccgcaggcctgggcttcacggtggccaacggcggccgctacgacaac
ctgctgcgccgcttcggggagccgctcccggcgacggggttcgccatctcgctggagcgg
ctggtctcggtgctgccgccggagaggcccgccccgctgctggtgctcgtcggggaggac
gcggaggcggtgcgcgccgcccgcgcgctgcggggggagggtgtcccggtgctgcacgtc
tccggagggctcgccccggaggaggccgagcgctacgcccgctcggtggacgcccgctgg
gttggctacccggccccgggcggggtgaagctgcgggaggtgggggagggcggcttttgg
cttctcgcggtggaggaggccgcgcggagggttctgggttga

DBGET integrated database retrieval system