KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0242Help
Entry
SAUSA300_0242     CDS       T00323                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00040  Pentose and glucuronate interconversions
saa00051  Fructose and mannose metabolism
saa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAUSA300_0242 (gutB)
   00051 Fructose and mannose metabolism
    SAUSA300_0242 (gutB)
Enzymes [BR:saa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAUSA300_0242 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 NAD_binding_3 AdoHcyase_NAD ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 CHASE4
Motif
Other DBs
NCBI-ProteinID: ABD20801
UniProt: A0A0H2XGC2
LinkDB All DBs
Position
291718..292773
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAYHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKVLLKTLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacatctgaaacgacattctatgtttgtaatgagtgtgaatactgtaaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtatcgtatcag
tctgcagctatgacagaaccattagcatgtgcatatcatggcgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggacctgggccaatcggattacttgtagcacaa
gtgttaaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatccggcgaaggtattaaagtattacttaag
acgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system