KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1650Help
Entry
SAUSA300_1650     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00920  Sulfur metabolism
saa01100  Metabolic pathways
saa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAUSA300_1650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saa03400]
    SAUSA300_1650
Enzymes [BR:saa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SAUSA300_1650
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     SAUSA300_1650
DNA repair and recombination proteins [BR:saa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    SAUSA300_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHH DHHA1
Motif
Other DBs
NCBI-ProteinID: ABD20662
UniProt: A0A0H2XFX6
LinkDB All DBs
Position
complement(1814672..1815613)
Genome map
AA seq 313 aa AA seqDB search
MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGRKLIKIDHHPAVDQYGDINLVN
TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
VNTIADIKGLKIWVFAVDEGNEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVDSWDE
FEQLATALRTKLN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattagtactttgaatgaaattatgaaatgtatcgaagacaacgatacaattattata
cacagacatgttagaccagatcctgatgcatatggttcacaacttggtttaaaatactat
attcagcagaaatttccgcaaaagcaagtatttgcagtgggtgaagcggaatcatcatta
agttttattggagagttagataacattgatgataaaacatatcaagatgcgcttgtaatt
gtatgtgatactgccaatgctccacgaattgacgatgaacgttatagtacaggtcgtaaa
cttattaaaatagatcatcatcctgcagttgatcagtatggtgatattaatttagttaat
acgaacgcgtcatctacaagtgaaatcatttacgatttaatctcacattttaatgatgaa
gcaattgttaataaagatatcgcgagcgttttatatcttggtatcgtcggtgatactggg
cgattcctttttaacaatacctcagaacatactatggaaattgctggaaagttaattggg
catgatattgatcataatgcgcttttaaataaaatgatggagaaggacccaaaaatgttg
ccgtttcaaggttatgttttacaacatttcgaacttatggatgatggattctgccaagtt
aaaataactgaagatgtattggagcaattcggtattcagccaaatgaagcatctcagttt
gttaatacaattgctgacatcaaaggcttgaaaatatgggtatttgcagtcgatgaaggt
aatgaaatcagatgtcgattacgttctaaagggcaattgattattaatgatattgcgcaa
gattttggtggcggtggtcatccgaatgcgtcaggagtttcagtggacagctgggatgaa
tttgagcaacttgctacagctttacgcacaaaacttaactaa

DBGET integrated database retrieval system