KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2006Help
Entry
SAUSA300_2006     CDS       T00323                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00290  Valine, leucine and isoleucine biosynthesis
saa00770  Pantothenate and CoA biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01130  Biosynthesis of antibiotics
saa01210  2-Oxocarboxylic acid metabolism
saa01230  Biosynthesis of amino acids
Module
saa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
saa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAUSA300_2006 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAUSA300_2006 (ilvD)
Enzymes [BR:saa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SAUSA300_2006 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD adh_short_C2
Motif
Other DBs
NCBI-ProteinID: ABD22626
UniProt: Q2FF71
LinkDB All DBs
Position
2164873..2166561
Genome map
AA seq 562 aa AA seqDB search
MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKPFVAICNSYIDIVPGHVHLRELADIAK
EAIREAGAIPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADAAETVINAHWFDGVFYIPN
CDKITPGMILAAMRTNVPAIFCSGGPMKAGLSAHGKALTLSSMFEAVGAFKEGSISKEEF
LDMEQNACPTCGSCAGMFTANSMNCLMEVLGLTLPYNGTALAVSDQRREMIRQAAFKLVE
NIKNDLKPRDIVTREAIDDAFALDMAMGGSTNTVLHTLAIANEAGIDYDLERINAIAKRT
PYLSKIAPSSSYSMHDVHEAGGVPAIINELMKKDGTLHPDRITVTGKTLRENNEGKEIKN
FDVIHPLDAPYDAQGGLSILFGNIAPKGAVIKVGGVDPSIKTFTGKAICFNSHDEAVEAI
DNRTVRAGHVVVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAV
GHISPEAASGGPIALIEDGDEITIDLTNRTLNVNQPEDVLARRRESLTPFKAKVKTGYLA
RYTALVTSANTGGVMQVPENLI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcgacatgatcaaaaaaggagatcaccaagcaccagcaagaagtcttttacat
gccacgggcgcgctaaaaagtccaactgatatgaacaaaccatttgtagctatttgtaac
tcttatattgatattgttcctggacatgttcacttgagagagcttgcagatatagctaaa
gaagcaattagagaagccggtgccattccatttgaattcaatacaattggtgttgatgat
ggaatagctatgggacatatcggaatgcgatattctctaccatcacgtgaaattattgca
gatgcagctgaaactgtaattaacgctcattggtttgacggcgtattttacattcctaat
tgtgacaagattacacccggtatgattttagcagccatgaggacaaacgtaccagctatc
ttttgctctggtggaccaatgaaagctggcttatctgcacatggaaaagcattaacactt
tcatcaatgtttgaagcagtcggcgcatttaaagaaggatcgatttctaaagaagaattt
ttagatatggaacaaaatgcctgccctacttgtggttcatgtgctgggatgtttactgca
aattcaatgaactgtttgatggaagttttaggtctaacattaccatacaacggtactgca
cttgcagtcagtgatcagcgacgagaaatgattcgccaagcagcttttaaattagttgaa
aatattaaaaatgatttaaaaccacgtgatatcgttactcgcgaagcaattgatgatgca
tttgcacttgatatggctatgggtggttcaacaaacacggtactgcatacgttagccatt
gccaatgaagctggtattgattatgacttagagcgcattaatgctattgccaaacgcacg
ccatatttatcaaaaatagcacctagttcatcgtattcaatgcatgatgtgcatgaagct
ggtggcgtcccagcaattattaatgaattgatgaagaaagatggcacgttacacccagat
agaatcacagttactggcaaaacgttacgtgaaaataacgaaggcaaagaaattaagaac
tttgatgtcattcaccctcttgatgcaccatatgatgcacaaggcggtttatctatctta
tttggtaatatcgcccctaaaggcgcagttattaaagttggcggcgttgatccatctatc
aaaacatttactgggaaagcaatttgtttcaattcgcatgatgaagctgttgaagcaata
gacaatcgtaccgttcgtgcaggccacgtcgttgtcattagatatgaaggacctaaaggt
ggaccaggtatgcctgaaatgttagcacctacttcctctattgttggtcgcggcttaggt
aaagatgttgcattaattactgatgggcgtttttccggtgccacaagaggtattgcagtt
ggtcatatttcccctgaagctgcatctggtggaccaattgccttaattgaagatggtgat
gagattactattgatttaacaaatcgtacattaaacgtaaaccagcctgaagatgttcta
gcgcgtcgccgagaatctttaacaccatttaaagcgaaagtaaaaacaggttatctagct
cgttatactgccctagtaactagcgcaaatacaggtggcgtcatgcaagtccctgagaat
ttaatttaa

DBGET integrated database retrieval system