KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2057Help
Entry
SAUSA300_2057     CDS       T00323                                 

Gene name
atpC
Definition
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00190  Oxidative phosphorylation
saa01100  Metabolic pathways
Module
saa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAUSA300_2057 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:saa00194]
    SAUSA300_2057 (atpC)
Photosynthesis proteins [BR:saa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SAUSA300_2057 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DUF2016
Motif
Other DBs
NCBI-ProteinID: ABD20802
UniProt: Q2FF25
LinkDB All DBs
Position
complement(2220517..2220921)
Genome map
AA seq 134 aa AA seqDB search
MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
LERANNRLRVAELK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattaaacctagatattgtcactcctaatggttctgtttacaatcgtgataat
gttgaactcgttgttatgcaaacaacagctggtgagataggtgtcatgagtggacatatt
ccaactgtagctgctttaaaaacaggctttgtaaaagtgaaatttcacgatggaactgaa
tatattgctgtaagcgatggctttgttgaagttagaaaagataaagtttcaatcattgtt
cagactgcagaaactgcaagagaaattgatgttgaaagagctaaattagccaaagcaaga
gcagagtctcacttggaaaatgatgacgacaatactgatattcatagagccgaaagagct
ttagagagagcaaataaccgtttgcgtgtggctgaattaaaatag

DBGET integrated database retrieval system