KEGG   Staphylococcus aureus RF122: SAB0891cHelp
Entry
SAB0891c          CDS       T00303                                 

Definition
(GenBank) probable transcription factor
  KO
K02250  competence protein ComK
Organism
sab  Staphylococcus aureus RF122
Pathway
sab02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sab00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAB0891c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sab03000]
    SAB0891c
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sab02044]
    SAB0891c
Transcription factors [BR:sab03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SAB0891c
Secretion system [BR:sab02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   SAB0891c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK Gemin7
Motif
Other DBs
NCBI-ProteinID: CAI80579
LinkDB All DBs
Position
complement(969737..970306)
Genome map
AA seq 189 aa AA seqDB search
MYPQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
LGKKSETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
VTFINNESIILHVSCHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
TRYSLFEDK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctcaaaatatttatgtgatacgcaaaggagacatggttattcgaccagcattt
gatgatgacgatcaaagaaatggtagcgaaataattcggtttgacaaaacgcgtattcaa
aatccttttaaagtccagaaaatcattgaacgctcttgcaaattttatggtaatacttat
cttggcaagaaatcagagacaaaccgcattactggcatttctagtaaaccacctatttta
ctaacaccattatttccaacttattttttcccaactcattctgacagacaaaatgaaaat
atttggttaaatatgcattatatcgaaagtattaaagaattaaaaaatcgtaaatgtaaa
gtgacatttattaataatgaatcaatcattcttcatgtttcatgccacagtttatggcat
caatataacaattccattttttactattacatggtagataaacaatctcgcatgatatca
aaaaatcccgaccaaccaatagattataataaagccacattgaatgtgtttgaagcattg
acacgctattctttatttgaagataaataa

DBGET integrated database retrieval system