KEGG   Staphylococcus aureus RF122: SAB1012Help
Entry
SAB1012           CDS       T00303                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00020  Citrate cycle (TCA cycle)
sab00190  Oxidative phosphorylation
sab00650  Butanoate metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
Module
sab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAB1012 (sdhA)
   00650 Butanoate metabolism
    SAB1012 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAB1012 (sdhA)
Enzymes [BR:sab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAB1012 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SAB1012 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAI80700
LinkDB All DBs
Position
1096726..1098492
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttgttctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgacttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggc
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
caccacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaaatatgaaggatgggaattc
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggttcagatgcagttattatggcaacgggtggccctggt
attattttcggtaaaacaacaaactcaatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaatc
cctggtgatgataaactacgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatgga
aacttagtacctcgtgatatcgcgacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtattaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtaaaactaggtggtatcattgaaatttatgaaaaattcactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgtccactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattgttatcagcgatttatggtggtaca
gtagcaggtccaaacgcgattgattatatttcaaatattgatcgatcatatactgatatg
gacgaaagtatttttgaaaaacgtaaagctgaagagcaagaacgttttgataaattatta
gctatgcgcggtacagaaaatgcatataaattacaccgtgaacttggtgaaattatgaca
gcaaatgtaactgttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaaacgttatgaagatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttactcgtcaattatggaacatgttagtacttgcacgtgttattacgatt
ggtgcatataaccgtaacgaatcacgcggggcccattataaaccagaattcccagagcgt
aatgatgaagagtggttaaaaacgacaatggcctcattccaaggcgcatttgaaaaacca
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system