KEGG   Staphylococcus aureus RF122: SAB1013Help
Entry
SAB1013           CDS       T00303                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00020  Citrate cycle (TCA cycle)
sab00190  Oxidative phosphorylation
sab00650  Butanoate metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
Module
sab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAB1013 (sdhB)
   00650 Butanoate metabolism
    SAB1013 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAB1013 (sdhB)
Enzymes [BR:sab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAB1013 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SAB1013 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CAI80701
LinkDB All DBs
Position
1098492..1099307
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaatcattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcatgtttaatggaaattaga
cgtaacccagttaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgc
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaatcgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aagcgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaagtt
tgtcctaatgttactgaaaacaataaatttgttggtgcgcaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaagatgaacgtttaaatgcattaatg
ggtacaggtggcttacagcaatgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system