KEGG   Staphylococcus aureus RF122: SAB2296cHelp
Entry
SAB2296c          CDS       T00303                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00010  Glycolysis / Gluconeogenesis
sab00260  Glycine, serine and threonine metabolism
sab00680  Methane metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
sab01230  Biosynthesis of amino acids
Module
sab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sab_M00002  Glycolysis, core module involving three-carbon compounds
sab_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAB2296c
  09102 Energy metabolism
   00680 Methane metabolism
    SAB2296c
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAB2296c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sab04131]
    SAB2296c
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sab04147]
    SAB2296c
Enzymes [BR:sab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAB2296c
Membrane trafficking [BR:sab04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAB2296c
Exosome [BR:sab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAB2296c
  Exosomal proteins of melanoma cells
   SAB2296c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAI81985
UniProt: Q2YVZ6
LinkDB All DBs
Position
complement(2426387..2427073)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaactgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system