KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0154Help
Entry
SACOL0154         CDS       T00225                                 

Gene name
aldA1
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00010  Glycolysis / Gluconeogenesis
sac00053  Ascorbate and aldarate metabolism
sac00071  Fatty acid degradation
sac00280  Valine, leucine and isoleucine degradation
sac00310  Lysine degradation
sac00330  Arginine and proline metabolism
sac00340  Histidine metabolism
sac00380  Tryptophan metabolism
sac00410  beta-Alanine metabolism
sac00561  Glycerolipid metabolism
sac00620  Pyruvate metabolism
sac00625  Chloroalkane and chloroalkene degradation
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL0154 (aldA1)
   00053 Ascorbate and aldarate metabolism
    SACOL0154 (aldA1)
   00620 Pyruvate metabolism
    SACOL0154 (aldA1)
  Lipid metabolism
   00071 Fatty acid degradation
    SACOL0154 (aldA1)
   00561 Glycerolipid metabolism
    SACOL0154 (aldA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACOL0154 (aldA1)
   00310 Lysine degradation
    SACOL0154 (aldA1)
   00330 Arginine and proline metabolism
    SACOL0154 (aldA1)
   00340 Histidine metabolism
    SACOL0154 (aldA1)
   00380 Tryptophan metabolism
    SACOL0154 (aldA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACOL0154 (aldA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACOL0154 (aldA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACOL0154 (aldA1)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SACOL0154 (aldA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AAW37451
UniProt: Q5HJK3
LinkDB All DBs
Position
171181..172668
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
aatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggcggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system