KEGG   Saccharibacillus sp. ATSA2: FFV09_11300Help
Entry
FFV09_11300       CDS       T06082                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
saca  Saccharibacillus sp. ATSA2
Pathway
saca00340  Histidine metabolism
saca01100  Metabolic pathways
saca01110  Biosynthesis of secondary metabolites
saca01230  Biosynthesis of amino acids
Module
saca_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:saca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    FFV09_11300
Enzymes [BR:saca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     FFV09_11300
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     FFV09_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: QDH21373
UniProt: A0A4Y6UUK0
LinkDB All DBs
Position
2691071..2691853
Genome map
AA seq 260 aa AA seqDB search
MNRENDVTLAPGQFAAQVKWDAQGLAPAIVQDAHSKEVLTLAYMNEESLRRSIEEGETWF
WSRSRQEFWHKGATSGNVQRIVSLSYDCDGDALLVGVIPAGPACHTGRVSCFFNKAELAG
GAAETGVIDAAGAGAESERVLGSEPEFAQTSAASAGAQESAGRFDVLGELEGIIAERDRE
RPEGAYTTYLFEKGIDKILKKVGEETAESIIAAKNGDNAELRLEVSDLIYHLLVLLQERK
LPLDEIMDELARRHERPRRD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagaaaacgatgtgacccttgcgcccgggcagtttgcggcgcaggtcaaatgg
gacgcgcaggggctggctccggcgatcgtgcaggacgcgcacagcaaggaagtgctgacg
ctcgcctacatgaacgaagaatcgctgcgccgctcgatcgaagaaggcgagacgtggttc
tggagccgttcgcggcaggaattttggcacaaaggcgcgacttcgggcaatgtgcagcgg
atcgtctcgctgagctacgattgcgacggcgacgcgctgctggtcggcgtcattccggcc
ggaccggcttgccacacgggacgggtaagctgcttcttcaacaaggcggagcttgcgggc
ggagcggcggaaacgggcgtgatcgacgcggccggcgccggtgcggaaagcgagcgcgtg
ctcggttcggagccggaattcgcgcagacgtcggcggcttctgccggagcgcaggagtcg
gccggacgtttcgacgtgctgggcgaactggaaggcatcatcgccgaacgcgaccgcgaa
cggccggaaggcgcgtacacgacgtatttgttcgaaaaagggatcgacaagattctcaaa
aaagtcggcgaagaaacggcggaatcgatcatcgcggccaaaaacggcgacaatgccgaa
ctgcgcctcgaagtgagcgacctgatctatcacctgctcgtgctgctgcaggagcgcaag
cttccgctggacgagatcatggacgagctggcgcgccggcacgaacgtccgcgccgcgac
tga

DBGET integrated database retrieval system